[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF07169.1


[Show Plain Result]

## Summary of Sequence Search
   1::454
 267::454  5.5e-49 38.0% 0052685 00526852 2/2   MPP-like metallohydrolase               
 265::454  1.9e-48 33.3% 0045938 00459382 2/2   MPP-like metallohydrolase               
 274::454  2.1e-45 33.7% 0046660 00466602 2/2   MPP-like metallohydrolase               
 273::450  1.4e-44 36.8% 0048873 00488732 2/2   MPP-like metallohydrolase               
 264::451  7.4e-44 33.3% 0045926 00459262 2/2   MPP-like metallohydrolase               
 274::454  1.4e-43 31.8% 0045937 00459372 2/2   MPP-like metallohydrolase               
 261::451  3.1e-43 32.1% 0047226 00472262 2/2   MPP-like metallohydrolase               
 274::455  5.9e-41 32.6% 0047225 00472252 2/2   MPP-like metallohydrolase               
 264::450  4.5e-38 30.6% 0035451 00354512 2/2   MPP-like metallohydrolase               
  34::261  1.4e-37 25.7% 0047224 00472241 1/2   MPP-like metallohydrolase               
  29::261  3.7e-37 26.3% 0045925 00459251 1/2   MPP-like metallohydrolase               
  19::256  8.9e-36 23.0% 0048875 00488751 1/2   MPP-like metallohydrolase               
 260::450  1.2e-35 34.1% 0035487 00354872 2/2   MPP-like metallohydrolase               
  49::261  1.5e-35 29.6% 0046661 00466611 1/2   MPP-like metallohydrolase               
  39::261  1.7e-35 27.5% 0037285 00372851 1/2   MPP-like metallohydrolase               
  36::259  2.4e-34 26.8% 0035487 00354871 1/2   MPP-like metallohydrolase               
  34::247    3e-34 27.1% 0045927 00459271 1/2   MPP-like metallohydrolase               
  26::260  1.8e-33 24.8% 0035485 00354851 1/2   MPP-like metallohydrolase               
 267::450  2.3e-33 32.6% 0045925 00459252 2/2   MPP-like metallohydrolase               
 263::450  2.5e-32 33.3% 0037285 00372852 2/2   MPP-like metallohydrolase               
  37::260  3.1e-32 25.9% 0038685 00386851 1/2   MPP-like metallohydrolase               
 274::450    1e-31 30.4% 0047224 00472242 2/2   MPP-like metallohydrolase               
  16::261  1.2e-31 24.0% 0052687 00526871 1/2   MPP-like metallohydrolase               
  43::253  1.3e-31 26.6% 0046660 00466601 1/2   MPP-like metallohydrolase               
 257::450  1.8e-31 31.5% 0048875 00488752 2/2   MPP-like metallohydrolase               
  42::253  7.3e-31 28.7% 0045937 00459371 1/2   MPP-like metallohydrolase               
 261::450  9.7e-31 30.9% 0035485 00354852 2/2   MPP-like metallohydrolase               
  39::259  3.1e-30 25.7% 0048872 00488721 1/2   MPP-like metallohydrolase               
  42::252  6.7e-30 27.4% 0045926 00459261 1/2   MPP-like metallohydrolase               
  46::265  5.3e-29 27.6% 0047225 00472251 1/2   MPP-like metallohydrolase               
  40::247  8.1e-29 26.4% 0047226 00472261 1/2   MPP-like metallohydrolase               
 261::450  1.1e-28 32.8% 0038685 00386852 2/2   MPP-like metallohydrolase               
 255::454  3.5e-28 25.3% 0052686 00526862 2/2   MPP-like metallohydrolase               
  43::244  1.5e-26 25.0% 0035451 00354511 1/2   MPP-like metallohydrolase               
  44::244  2.5e-26 25.0% 0045938 00459381 1/2   MPP-like metallohydrolase               
 272::451  6.1e-26 28.2% 0052687 00526872 2/2   MPP-like metallohydrolase               
 274::450  1.8e-25 28.4% 0046661 00466612 2/2   MPP-like metallohydrolase               
 257::450  4.4e-21 26.5% 0045927 00459272 2/2   MPP-like metallohydrolase               
 262::451  9.5e-10 29.3% 0037288 00372881 1/1   MPP-like metallohydrolase               
 128::255  4.8e-08 16.8% 0052685 00526851 1/2   MPP-like metallohydrolase               
 312::450  2.7e-07 15.8% 0048872 00488722 2/2   MPP-like metallohydrolase               
 125::241  1.9e-06 16.2% 0048873 00488731 1/2   MPP-like metallohydrolase               
 147::247        6 15.8% 0052686 00526861 1/2   MPP-like metallohydrolase               
   1::454


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSLSVMTIASPRLLRRLAGAAFGAAALLAGAVAHAAIPIESWTASTGAKVFFVPSPSIPMLDVNIDFDAG
00526852   2/2  ----------------------------------------------------------------------
00459382   2/2  ----------------------------------------------------------------------
00466602   2/2  ----------------------------------------------------------------------
00488732   2/2  ----------------------------------------------------------------------
00459262   2/2  ----------------------------------------------------------------------
00459372   2/2  ----------------------------------------------------------------------
00472262   2/2  ----------------------------------------------------------------------
00472252   2/2  ----------------------------------------------------------------------
00354512   2/2  ----------------------------------------------------------------------
00472241   1/2  ---------------------------------pplpevqvttlpnGlrvllvedpg.pqvalalafpag
00459251   1/2  ----------------------------lPkpnldipeprlltldnGlrvllvedp.apqvalalafpag
00488751   1/2  ------------------eldlpepnpfipkpelplpeprlitldnGlrvllvpdpdvpqaalalafptg
00354872   2/2  ----------------------------------------------------------------------
00466611   1/2  ------------------------------------------------lrvllvedps.pqvsvalafka
00372851   1/2  --------------------------------------iqvttlpnGlrvlvledp.vpqvslalafrag
00354871   1/2  -----------------------------------vpkitvttlpnGlrvvlvedp.apqvsvalafrag
00459271   1/2  ---------------------------------PldlpevqvltldnGlrvllvedpt.plvavslavda
00354851   1/2  -------------------------PnlpipppldlpkirvttlpnGlrvllvedp.apqaalalafpag
00459252   2/2  ----------------------------------------------------------------------
00372852   2/2  ----------------------------------------------------------------------
00386851   1/2  ------------------------------------PdprvltlpnGlrvllvpdpdapqaalalafrag
00472242   2/2  ----------------------------------------------------------------------
00526871   1/2  ---------------hlpepnpfippdftlkpeldlpepelltldnGlrvllvpdpdap.....lafgvg
00466601   1/2  ------------------------------------------Pplpnglrvvlvedp.vpqvalalafpg
00488752   2/2  ----------------------------------------------------------------------
00459371   1/2  -----------------------------------------ptlpngl.vvlvd.pdlpqvalalafpgg
00354852   2/2  ----------------------------------------------------------------------
00488721   1/2  --------------------------------------prlitldnglrvwlkqddtFasvpkaaialsv
00459261   1/2  -----------------------------------------eptlpnglrv..vedkpvpqvavalafpg
00472251   1/2  ---------------------------------------------Pplpnglrvvlvedpgagelepqva
00472261   1/2  ---------------------------------------pPeptlpnglrvvv.d.pdapqvavalafpg
00386852   2/2  ----------------------------------------------------------------------
00526862   2/2  ----------------------------------------------------------------------
00354511   1/2  ------------------------------------------plpnglrvvtvedp.vpqahvglafeag
00459381   1/2  -------------------------------------------Kpplpngvrvvdkpv.pqvalalafpg
00526872   2/2  ----------------------------------------------------------------------
00466612   2/2  ----------------------------------------------------------------------
00459272   2/2  ----------------------------------------------------------------------
00372881   1/1  ----------------------------------------------------------------------
00526851   1/2  ----------------------------------------------------------------------
00488722   2/2  ----------------------------------------------------------------------
00488731   1/2  ----------------------------------------------------------------------
00526861   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SRYDPPGKAGLATLTAALLDKGASAQDGQPARNEAQIADAFADTGADFGGAAGGDRGGIGLRTLTASPER
00526852   2/2  ----------------------------------------------------------------------
00459382   2/2  ----------------------------------------------------------------------
00466602   2/2  ----------------------------------------------------------------------
00488732   2/2  ----------------------------------------------------------------------
00459262   2/2  ----------------------------------------------------------------------
00459372   2/2  ----------------------------------------------------------------------
00472262   2/2  ----------------------------------------------------------------------
00472252   2/2  ----------------------------------------------------------------------
00354512   2/2  ----------------------------------------------------------------------
00472241   1/2  srdepdgkagaahllehllgggt......kklssrlfqelreklglaynast..drgltgyyasvlpedl
00459251   1/2  srddpdeaaglahllehllgggt......kklssrlfqelreklglaynast..drgltgyyasvlsedl
00488751   1/2  slddpdelsglahllehllggGt......kklsysrlfaelreklglaynast..srgltgyyasvlped
00354872   2/2  ----------------------------------------------------------------------
00466611   1/2  gsrdepdg..glahllehllfgGte......srlalelreelellggslnaytsrdltvyylstln..ed
00372851   1/2  srdepdglagllhllehllgggtssrl.............leklglaynayt..drglfgiyastlpdnl
00354871   1/2  srdepdglagllhllehllggg......tknlssrllqelreklglaysayt..drglfgiyasvlpedl
00459271   1/2  gsrdepddktglahllehllfk......Gtgklssrlfaelleklggslnaytsrdytvyylstln..ed
00354851   1/2  srddpdelaglahllehllfgGt......gklssrlfqelreklglaynast..drgltgyyasvlpedl
00459252   2/2  ----------------------------------------------------------------------
00372852   2/2  ----------------------------------------------------------------------
00386851   1/2  srddpdelagllhllehllggGt......kklssrllqelreklglaynast..drgltgiyastlpedl
00472242   2/2  ----------------------------------------------------------------------
00526871   1/2  spdepdedsglahllehllg......gGtssrpykelfqelrdeklglaynast..sfggtvyyasttlp
00466601   1/2  gsrddp..dagalhllnhlLGggdsfgtssrnlglklfqelrek.glaysv...gaslnaytdaglfgiy
00488752   2/2  ----------------------------------------------------------------------
00459371   1/2  srddp..dagalhllehllGggdsllfgGsgtssrlyqelrek.glaysv...gaslnaytdaglfgiya
00354852   2/2  ----------------------------------------------------------------------
00488721   1/2  dvgsasdpaknlglahllehllfdgl...........eeypyfaelaglsynayts...dgtnlslsgyn
00459261   1/2  gsrddp..dagalhllehllgggdsllggglgtssrlfqelrek.glaysv...gaslnaytdaglfgiy
00472251   1/2  valafpggsrddp..dagalhllehlLggggsfsagglgkgtssrlfqelreekglaysv...gaslnay
00472261   1/2  gsrddp..dygalhllehllgggdrflglgkgtssrlyqelreklglay...svgaslnaytdaglfgiy
00386852   2/2  ----------------------------------------------------------------------
00526862   2/2  ----------------------------------------------------------------------
00354511   1/2  srde.pd.agalhllehllgggssvgpgkgtssrlaqelreelglaysvgaflnayt..drglfgiyast
00459381   1/2  gsrddp..dygalhllnhlLggggslglgkgtssrlyqelreklglaysv...gaslnaytdaglfgiya
00526872   2/2  ----------------------------------------------------------------------
00466612   2/2  ----------------------------------------------------------------------
00459272   2/2  ----------------------------------------------------------------------
00372881   1/1  ----------------------------------------------------------------------
00526851   1/2  ---------------------------------------------------------dtglfviyadpnl
00488722   2/2  ----------------------------------------------------------------------
00488731   1/2  ------------------------------------------------------dtggfsiyvqspsksl
00526861   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EQSLRLAAQLIKSPTYPDAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSATAETVGSIT
00526852   2/2  ----------------------------------------------------------------------
00459382   2/2  ----------------------------------------------------------------------
00466602   2/2  ----------------------------------------------------------------------
00488732   2/2  ----------------------------------------------------------------------
00459262   2/2  ----------------------------------------------------------------------
00459372   2/2  ----------------------------------------------------------------------
00472262   2/2  ----------------------------------------------------------------------
00472252   2/2  ----------------------------------------------------------------------
00354512   2/2  ----------------------------------------------------------------------
00472241   1/2  eealdllldellnpgfteeeleraknvllaelllslespsglasrllrallygghpygrpllgllealea
00459251   1/2  eealdllldlllnpgfteeeleraknvllaelllaldspsslasrllsallygghpygrpllgllealea
00488751   1/2  leealdllldllrnpgfteeeleraknvllaelrlaldspsslasrllsallygghpygrpllglleale
00354872   2/2  ----------------------------------------------------------------------
00466611   1/2  leealdlladlllnplfdeeellerekgvvlselklrldspsslafellrally.ghpygrpelgesiea
00372851   1/2  eealellldellnlaeegfteeeleraknqllaelllsldslpsalasellrqllyggdplgrpllgtle
00354871   1/2  eealdlladelarlgfteeeleraknvllaelllalespsglaedllrqllyg.gplgrpllgtleriea
00459271   1/2  leealdlladlllnplfdeeelerekgvvleelklrldspsslafellrallygg.pygrpilgtlesle
00354851   1/2  eealellldvlrnpgfteeeleraknvllaelllalespsslasdllrqllygghpygrpllgllealea
00459252   2/2  ----------------------------------------------------------------------
00372852   2/2  ----------------------------------------------------------------------
00386851   1/2  eealdllldvllnpgfteeeleraknvllaelllaldspsslasrllrqllygghpygrpllgllealea
00472242   2/2  ----------------------------------------------------------------------
00526871   1/2  ekleealdllldellnpgfteeeleflqegwrleledldselrakevvlaelklaldspsslasrllsal
00466601   1/2  astlp.genleealellldelanlaeefteeeleraknqllaelllsldspsglllasrllrallygghp
00488752   2/2  ----------------------------------------------------------------------
00459371   1/2  stlpe..dleealellldelanllpgfteeeleraknvllaelllsldspsglasrllrallygghpypl
00354852   2/2  ----------------------------------------------------------------------
00488721   1/2  dklpelldlfldflinplfteeeferekeallselknalqsqpyrlasqllssllypdhp.fliglletl
00459261   1/2  astlpe..dleealellldelanlapgfteeeleraknqllaelllsldspsglasrllrallyggdpyp
00472251   1/2  tdaglfgiyastlpe..dleealdllldelanlaeellpgfteeeleraknqllaelllsldspsglasr
00472261   1/2  astlpevqdleealdllldelerllnpgfteeeleraknqllaelllsldspsglasrllsallyggdpy
00386852   2/2  ----------------------------------------------------------------------
00526862   2/2  ----------------------------------------------------------------------
00354511   1/2  lpedldealdlladellrlategfteeeleraKnqllaelllslesptglaeellrqllygghplpllgt
00459381   1/2  stlpe..nleealellldelanlaepgfteeeleraknqllaelllsldspsglasrllsallyggdpyp
00526872   2/2  ----------------------------------------------------------------------
00466612   2/2  ----------------------------------------------------------------------
00459272   2/2  ----------------------------------------------------------------------
00372881   1/1  ----------------------------------------------------------------------
00526851   1/2  dealeaileelerlaeegvteeeLerakaqligslllsl.spsglaerlgrqllygldpdyleellerie
00488722   2/2  ----------------------------------------------------------------------
00488731   1/2  eellerileflkkfaelleglteeeleraKesligslllkleslssrasrlwseillggldfdyleelie
00526861   1/2  ------tleelaeegfdeeeleaailglelslldspespsskGlslalrllsywlyggdpldllkllell


                         -         -         -         +         -         -         -:280
query           HDDLVKFWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQMTIPASEQRIPHPAQQ
00526852   2/2  --------------------------------------------------------ppgkrevvvkdapq
00459382   2/2  ------------------------------------------------------Kpplpngvrvvdkpvp
00466602   2/2  ---------------------------------------------------------------Pplpngl
00488732   2/2  --------------------------------------------------------------elpvvelp
00459262   2/2  -----------------------------------------------------eptlpnglrvvedkpvp
00459372   2/2  ---------------------------------------------------------------ptlpngl
00472262   2/2  --------------------------------------------------pP.eptlpnglrvvvdpdap
00472252   2/2  ---------------------------------------------------------------Pplpngl
00354512   2/2  -----------------------------------------------------plpnglrvvtvedpvpq
00472241   1/2  vtledlkafakkylspdnlvlvvvG.vdpeellalleklfgdlpagplppp-------------------
00459251   1/2  vtledlkafakkylspdnlvlvvvGdvdpeellalleklfgdlpagplppp-------------------
00488751   1/2  avtgidlledlkafakkylspdnmvlvvvGdvdleellklvekyfg------------------------
00354872   2/2  -------------------------------------------------vpkitvttlpnGlrvvlvedp
00466611   1/2  itledlkafykkyyspdnmvlvvvGdvd.eellalleklyfgdlpagp.Pe-------------------
00372851   1/2  rieavtledlqafakkyltpdnlvlvvvGdvdheellalleklfgdlpagp-------------------
00354871   1/2  vtledlqafarkyltpdnlvlvvvG.vdheellalleklfgdlpagplp---------------------
00459271   1/2  altledlkafykkyyspdnmvlvvvG.vdleellkll---------------------------------
00354851   1/2  vtledlkafakkyyspdnmvlvvvGdvdpeellallekyfgdlpsgplpp--------------------
00459252   2/2  --------------------------------------------------------lPkpnldipeprll
00372852   2/2  ----------------------------------------------------iqvttlpnGlrvlvledp
00386851   1/2  vtledlkafakkylspdnlvlvvvGdvdpeellklleklfgdlpagplpp--------------------
00472242   2/2  ---------------------------------------------------------------vedpgpq
00526871   1/2  lygghpygrpilgllealeavtledlkafakkylspnnmvlvvvGdidlee-------------------
00466601   1/2  ypilgtlerieavtledvkavakkyltpdnavlvvvGdvdpee---------------------------
00488752   2/2  ----------------------------------------------eldlpepnpfipkpelplpeprli
00459371   1/2  lgtlerieavtledlkafakkyltpdnavlvvvGdvdpeella---------------------------
00354852   2/2  --------------------------------------------------Pnlpipppldlpkirvttlp
00488721   1/2  esitledllafykklysannmellvvGnldleealelveklfsslpnkp---------------------
00459261   1/2  llgtlerieavtledlkafakkyltpdnavlvvvGdvdpeel----------------------------
00472251   1/2  llrallyggdpypllgtlerieavtledlkafakkylspd...lvvvGdvdpeea---------------
00472261   1/2  pllgtlerieavtledlkafakkyltpdnavlvvvGd---------------------------------
00386852   2/2  --------------------------------------------------PdprvltlpnGlrvllvpdp
00526862   2/2  --------------------------------------------lqkpfgepkrvtveyplealeppedv
00354511   1/2  leridavtledvqafakkyltp.nlvlvvvGdvd------------------------------------
00459381   1/2  llgtlerieavtledlkavakkylspd.avlvvv------------------------------------
00526872   2/2  -------------------------------------------------------------hlpepnpfi
00466612   2/2  ---------------------------------------------------------------lrvllve
00459272   2/2  ----------------------------------------------PldlpevqvltldnGlrvllvedp
00372881   1/1  ---------------------------------------------------ldkakylggelrveldgeq
00526851   1/2  avtledvqrvakkylkpldnltvvvvgpae..klkellealggvl-------------------------
00488722   2/2  ----------------------------------------------------------------------
00488731   1/2  aieavtkedvirfakkylkpdnlvllvvgpv---------------------------------------
00526861   1/2  qklreellsgvtledlkelakkylldnnhrvvvvlvP---------------------------------


                         -         *         -         -         -         -         +:350
query           ASVALGQPAIARGDPDYFPLLVGNYVLGGGGFSSRLTDQVREKRGLTYGVDSYFSPSKQPGPFSVSLQTK
00526852   2/2  aylalgypgpsygdpdyaallvlntiLggg....rLfqelrek.glaygvgssldsysdtglfviyadp.
00459382   2/2  qvalalafpggsrddpdygalhllnhlLggggslglgkgtssrlyqelreklglaysvgaslnaytdagl
00466602   2/2  rvvlvedpvpqvalalafpggsrddpdagalhllnhlL.Gggdsfgtssrnlglklfqelrek.glaysv
00488732   2/2  lggnlvyvvdlpleqnsivlgylqigrddpdyy...vlnelLg.gglssrlfqeLRekegLgYsVfsgfr
00459262   2/2  qvavalafpggsrddpdagalhllehllgggdsllggglgtssrlfqelrek.glaysvgaslnaytdag
00459372   2/2  vvlvdpdlpqvalalafpggsrddpdagalhllehllGggdsllfgGsgtssrlyqelrek.glaysvga
00472262   2/2  qvavalafpggsrddpdygalhllehllgggdrflglgkgtssrlyqelreklglaysvgaslnaytdag
00472252   2/2  rvvlvedpgagelepqvavalafpggsrddpdagalhllehlLggggsfsagglgkgtssrlfqelreek
00354512   2/2  ahvglafeagsrdepdagalhllehllgggssvgpgkgtssrlaqelreelglaysvgaflnaytdrglf
00472241   1/2  ----------------------------------------------------------------------
00459251   1/2  ----------------------------------------------------------------------
00488751   1/2  ----------------------------------------------------------------------
00354872   2/2  apqvsvalafragsrdepdglagllhllehllgggtknlssrllqelreklglaysayt......drglf
00466611   1/2  ----------------------------------------------------------------------
00372851   1/2  ----------------------------------------------------------------------
00354871   1/2  ----------------------------------------------------------------------
00459271   1/2  ----------------------------------------------------------------------
00354851   1/2  ----------------------------------------------------------------------
00459252   2/2  tldnGlrvllvedpapqvalalafpagsrddpdeaaglahllehllgggtkklssrlfqelreklglayn
00372852   2/2  vpqvslalafragsrdepdglagllhllehllgg.gtssrl....leklglaynayt......drglfgi
00386851   1/2  ----------------------------------------------------------------------
00472242   2/2  valalafpagsrdepdgkagaahllehllgggtkklssrlfqelreklglaynast......drgltgyy
00526871   1/2  ----------------------------------------------------------------------
00466601   1/2  ----------------------------------------------------------------------
00488752   2/2  tldnGlrvllvpdpdvpqaalalafptgslddpdelsglahllehllgg.Gtkklsysrlfaelreklgl
00459371   1/2  ----------------------------------------------------------------------
00354852   2/2  nGlrvllvedpapqaalalafpagsrddpdelaglahllehllfgGtgklssrlfqelreklglaynast
00488721   1/2  ----------------------------------------------------------------------
00459261   1/2  ----------------------------------------------------------------------
00472251   1/2  ----------------------------------------------------------------------
00472261   1/2  ----------------------------------------------------------------------
00386852   2/2  dapqaalalafragsrddpdelagllhllehllgg.Gtkklssrllqelreklglaynast......drg
00526862   2/2  syvalawllpdlsydhedllalsvlselLgg.gpsSpLykalrek.glAygvgasgldsdlleglfsfgl
00354511   1/2  ----------------------------------------------------------------------
00459381   1/2  ----------------------------------------------------------------------
00526872   2/2  ppdftlkpeldlpepelltldnGlrvllvpdpdaplafgvgspdepdedsglahllehllgg.Gtssrpy
00466612   2/2  dpspqvsvalafkagsrdepdgglahllehllfg.Gtesrlalelreelellggslnayt...srdltvy
00459272   2/2  tplvavslavdagsrdepddktglahllehllfkGtgklssrlfaelleklggslnaytsr......dyt
00372881   1/1  vhl.igvpv...ndedaaalevLanlLGg.glssrlgqe..........vsafnlsysDsGlFgiyvltd
00526851   1/2  ----------------------------------------------------------------------
00488722   2/2  -------------------------------lehllfdgleeypyfaelaglsynayts.dgtnlslsgy
00488731   1/2  ----------------------------------------------------------------------
00526861   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           KENTNEALALVREIVAKYVAEGPTDAELRAAKDNLVNGFPLRIDSNRKLLTNVANIGWYGLPLDYLDTWT
00526852   2/2  ..nldealeaileelerlaeegvteeeLerakaqligslllsl.spsglaerlgrqllygldpdyleell
00459382   2/2  fgiyastlpenleealellldelanlaepgfteeeleraknqllaelllsldspsglasrllsallyggd
00466602   2/2  gaslnaytdaglfgiyastlpgenleealellldelanlaee.fteeeleraknqllaelllsldspsgl
00488732   2/2  plsdtggfsiyvqspsksleellerileflkkfaelleglteeeleraKesligslllkleslssrasrl
00459262   2/2  lfgiyastlpedleealellldelanla.pgfteeeleraknqllaelllsldspsglasrllrallygg
00459372   2/2  slnaytdaglfgiyastlpedleealellldelanll.pgfteeeleraknvllaelllsldspsglasr
00472262   2/2  lfgiyastlpevqdleealdllldelerllnpgfteeeleraknqllaelllsldspsglasrllsally
00472252   2/2  glaysvgaslnaytdaglfgiyastlpedleealdllldelanlaeellpgfteeeleraknqllaelll
00354512   2/2  giyastlpedldealdlladellrlategfteeeleraKnqllaelllslesptglaeellrqllygghp
00472241   1/2  ----------------------------------------------------------------------
00459251   1/2  ----------------------------------------------------------------------
00488751   1/2  ----------------------------------------------------------------------
00354872   2/2  giyasvlpedleealdlladelarl...gfteeeleraknvllaelllalespsglaedllrqllyggpl
00466611   1/2  ----------------------------------------------------------------------
00372851   1/2  ----------------------------------------------------------------------
00354871   1/2  ----------------------------------------------------------------------
00459271   1/2  ----------------------------------------------------------------------
00354851   1/2  ----------------------------------------------------------------------
00459252   2/2  ast......drgltgyyasvlsedleealdllldlllnp...gfteeeleraknvllaelllaldspssl
00372852   2/2  yastlpdnleealellldellnlaeegfteeeleraknqllaelllsldslpsalasellrqllyggdpl
00386851   1/2  ----------------------------------------------------------------------
00472242   2/2  asvlpedleealdllldellnp...gfteeeleraknvllaelllslespsglasrllrallygghpygr
00526871   1/2  ----------------------------------------------------------------------
00466601   1/2  ----------------------------------------------------------------------
00488752   2/2  aynast......srgltgyyasvlpedleealdllldllrnp...gfteeeleraknvllaelrlaldsp
00459371   1/2  ----------------------------------------------------------------------
00354852   2/2  ......drgltgyyasvlpedleealellldvlrnp...gfteeeleraknvllaelllalespsslasd
00488721   1/2  ----------------------------------------------------------------------
00459261   1/2  ----------------------------------------------------------------------
00472251   1/2  ----------------------------------------------------------------------
00472261   1/2  ----------------------------------------------------------------------
00386852   2/2  ltgiyastlpedleealdllldvllnp...gfteeeleraknvllaelllaldspsslasrllrqllygg
00526862   2/2  ksyrdpnlekvleviletleelaeegfdeeeleaailglelslldspespsskGlslalrllsywlyggd
00354511   1/2  ----------------------------------------------------------------------
00459381   1/2  ----------------------------------------------------------------------
00526872   2/2  kelfqelrdeklglaynast......sfggtvyyasttlpekleealdllldellnp...gfteeelefl
00466612   2/2  ylstlnedleealdlladlllnpl...fdeeellerekgvvlselklrldspsslafellrallyghpyg
00459272   2/2  vyylstlnedleealdlladlllnpl...fdeeelerekgvvleelklrldspsslafellrallyggpy
00372881   1/1  aa......kvvaaevkklkaggvteeelsrAkeqlklslllslesvssll....................
00526851   1/2  ----------------------------------------------------------------------
00488722   2/2  ndklpelldlfldflinp...lfteeeferekeallselknalqsqpyrlasqllssllypdhp..flig
00488731   1/2  ----------------------------------------------------------------------
00526861   1/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           SQINKVTREQVRAAFQRHVHPDAMATVIVGGPEK------------------------------------
00526852   2/2  erieavtledvqrvakkylkpldnltvvvvgpae------------------------------------
00459382   2/2  pypllgtlerieavtledlkavakkylspd.avl------------------------------------
00466602   2/2  llasrllrallygghpypilgtlerieavtledv------------------------------------
00488732   2/2  wseillggldfdyleelieaieavtkedvi----------------------------------------
00459262   2/2  dpypllgtlerieavtledlkafakkyltpd---------------------------------------
00459372   2/2  llrallygghpypllgtlerieavtledlkafak------------------------------------
00472262   2/2  ggdpypllgtlerieavtledlkafakkylt---------------------------------------
00472252   2/2  sldspsglasrllrallyggdpypllgtlerieav-----------------------------------
00354512   2/2  lpllgtleridavtledvqafakkyltp.n----------------------------------------
00472241   1/2  ----------------------------------------------------------------------
00459251   1/2  ----------------------------------------------------------------------
00488751   1/2  ----------------------------------------------------------------------
00354872   2/2  grpllgtlerieavtledlqafarkyltpd----------------------------------------
00466611   1/2  ----------------------------------------------------------------------
00372851   1/2  ----------------------------------------------------------------------
00354871   1/2  ----------------------------------------------------------------------
00459271   1/2  ----------------------------------------------------------------------
00354851   1/2  ----------------------------------------------------------------------
00459252   2/2  asrllsallygghpygrpllgllealeavt----------------------------------------
00372852   2/2  grpllgtlerieavtledlqafakkyltpd----------------------------------------
00386851   1/2  ----------------------------------------------------------------------
00472242   2/2  pllgllealeavtledlkafakkylspdnl----------------------------------------
00526871   1/2  ----------------------------------------------------------------------
00466601   1/2  ----------------------------------------------------------------------
00488752   2/2  sslasrllsallygghpygrpllglleale----------------------------------------
00459371   1/2  ----------------------------------------------------------------------
00354852   2/2  llrqllygghpygrpllgllealeavtled----------------------------------------
00488721   1/2  ----------------------------------------------------------------------
00459261   1/2  ----------------------------------------------------------------------
00472251   1/2  ----------------------------------------------------------------------
00472261   1/2  ----------------------------------------------------------------------
00386852   2/2  hpygrpllgllealeavtledlkafakkyl----------------------------------------
00526862   2/2  pldllkllellqklreellsgvtledlkelakky------------------------------------
00354511   1/2  ----------------------------------------------------------------------
00459381   1/2  ----------------------------------------------------------------------
00526872   2/2  qegwrleledldselrakevvlaelklalds---------------------------------------
00466612   2/2  rpelg.esieaitledlkafykkyyspdnm----------------------------------------
00459272   2/2  grpilgtleslealtledlkafykkyyspd----------------------------------------
00372881   1/1  ........edvkeaakklls.gklsvaavGd---------------------------------------
00526851   1/2  ----------------------------------------------------------------------
00488722   2/2  lletlesitledllafykklysannmellv----------------------------------------
00488731   1/2  ----------------------------------------------------------------------
00526861   1/2  ----------------------------------------------------------------------