[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF07698.1


[Show Plain Result]

## Summary of Sequence Search
   1::115
   3::116  2.7e-41 57.0% 0042634 00426341 1/1   like                                    
   1::115  4.8e-41 55.0% 0037500 00375001 1/1   like                                    
   3::116  5.8e-40 55.5% 0040252 00402521 1/1   like                                    
   7::116  6.7e-38 56.6% 0035884 00358841 1/1   like                                    
   3::115    2e-37 57.9% 0039784 00397841 1/1   like                                    
   2::115  1.7e-36 55.5% 0049810 00498101 1/1   like                                    
   7::116  1.9e-36 54.7% 0035600 00356001 1/1   like                                    
   1::117  3.7e-36 52.2% 0043182 00431821 1/1   like                                    
   1::116  4.9e-36 53.6% 0045075 00450751 1/1   like                                    
   8::116  8.8e-36 54.3% 0040249 00402491 1/1   like                                    
   6::116  2.1e-35 56.1% 0042239 00422391 1/1   like                                    
   2::115  2.4e-35 54.5% 0041183 00411831 1/1   like                                    
   1::115  2.6e-32 58.3% 0040250 00402501 1/1   like                                    
   1::115  2.3e-31 56.5% 0040253 00402531 1/1   like                                    
  20::117  4.6e-31 54.3% 0039255 00392551 1/1   like                                    
   1::115    5e-31 55.2% 0042567 00425671 1/1   like                                    
   2::115  7.7e-28 53.9% 0043832 00438321 1/1   like                                    
   7::115    1e-27 55.7% 0040355 00403551 1/1   like                                    
   2::115  1.6e-26 52.9% 0044934 00449341 1/1   like                                    
  20::116  8.9e-24 57.6% 0038779 00387791 1/1   like                                    
   1::115


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQTTPSGLQFEDTVVGSGDEAKAGKHVTVHYTGWLFENGQAGRKFDSSKDRNDPFVFPLGAGHVIRGWDE
00426341   1/1  --tldsgllykvlkegegekpkkgdtVtvhYvgtlid....Gtvfdssydrgkplefglg.g.vipGfee
00375001   1/1  vvtldsgllykvlkegdgekpkkgdtVtvhYtgtlld....GtvFdssy..grpfpftlglgqvipGfee
00402521   1/1  --lldsgllkkilkegegdrkpkkgdtVtvhytgklld....gtvfdssydrgeplefvlgkgqvipgle
00358841   1/1  ------gllkkvlkegegdlkpkkgdtVtvhytgklld....gtvfdssydrgeplefvlgsgqvipgle
00397841   1/1  --tldsgllkkvlkegegarkpkkgdtVtvhytgklld....Gtvfdssydr..plpftlglgqvipGle
00498101   1/1  -lgvvttdsgllykvlkegegakpkkgdtVtvhytgklld....gtvfdssydrgepleftlgsgqvipg
00356001   1/1  ------GllkkvlvegegalkpkkgdtVtvhytgtlld....gtvfdssydrgeplefvlgsgqvipgle
00431821   1/1  ledlvilldsgllkkilkegegdrkpkkgdtVtvhytgtlld....gtvfdssygrgeplefvlgsgqvi
00450751   1/1  vllldsgllkkvlvegegdrkpkkgdlVtvhytgtlld....gtvfdssygrgeplefvlgsgqvipgle
00402491   1/1  -------llkkvlkegegalkpkkgdtVtvhytgklld....gtvfdssygrgeplefvlgkgqvipgle
00422391   1/1  -----sgllkkvlkegegplkpkkgdvVtvhytgtlld....gkvfdssydrlaleaglgeplefllgsg
00411831   1/1  -illdsgllklilkegtgdrkpkkgdtVtvhytgtlld....gtvfdssygrgeplefvlgsgqvipgle
00402501   1/1  dlviltdggllkkilkegdgaekpkkgdtvtvhytgkl.....dgtvfdssydr..pltftlglgqvipg
00402531   1/1  dlviltdggllkkilkegdgaekpkkgdvVtvhytgkl.....dgtvfdssyer..pleftlglgqvipg
00392551   1/1  -------------------kvkkgdvVtvhytgtlld....gtvfdssyerlakeagilleggegepltf
00425671   1/1  dlvitldggllkkilkegeglekpkkgdvVtvhytgtlld....gtvfds......plefvlgegqllgv
00438321   1/1  -edvdktleslleklallegvgraakkgdtVtvdytgtl.d....gevfdssydr..pfsfvlglgqvip
00403551   1/1  ------gllylvllegegraakkgdvVtvdytgtl.....dgevfdssydr..pfsfvlgsgqvipglee
00449341   1/1  -vtdedvdeeleslleklallegvgraakkgdtVtvdytgtl.....dgevfdssydr..pfsfvlgsgq
00387791   1/1  -------------------aakkgdlvtvdyvgtl.....dgevfdssldr..pfsftlgsgqvipgfee


                         -         -         *         -         -         -         -:140
query           GVQGMKVGGTRRLVIPADLGYGARGAGGVIPPNATLLFEVELLAV-------------------------
00426341   1/1  gllgmkvGekrkltiPpelAYgeeglgg.ippnatLvFeveLldvk------------------------
00375001   1/1  gLlgmkvGekreltippelaYgerglpglippgatlvFeveLldv-------------------------
00402521   1/1  egllgmkvGekrlltippelaYgerglgllippgatlvFeveLldv------------------------
00358841   1/1  egllgmkvGekrtltippelaYgerglgglipagatlvFeveLldv------------------------
00397841   1/1  egllgmkvGekrlltippelaYgerglgglippgatlvFeveLld-------------------------
00498101   1/1  leeallggealpemkvGekrtltippelaYgergaglvqlvplip-------------------------
00356001   1/1  eallgmkvGekalltippelaYgerglglvipagatlvFevelldv------------------------
00431821   1/1  pgleeallgmkvGekrlltippelaygerglgnlippgatlvFeveL-----------------------
00450751   1/1  egllgmkvGekrlltippelaYgerglpnlippgatlvFeveLldv------------------------
00402491   1/1  egllgmkvGekrlltippelaYgerglgllippgatlvFeveLldv------------------------
00422391   1/1  qvipgleeallgmkvGekalltippelaYGergaglvqippgatLv------------------------
00411831   1/1  egllgmkvGekrlltippelaYgerglpglippgatlvFeveLld-------------------------
00402501   1/1  ldeallgmkvGekalltippelaYgergaggvvippnatlvfeve-------------------------
00402531   1/1  leeallgmkvGekalltippelaYGergaggvgippnatlvFeve-------------------------
00392551   1/1  vlGsgqvipgleeallgmkvGekrtltippelaYgergpglvilvpl-----------------------
00425671   1/1  ipgleeallgmkvGekakltippelaYGergaggvlippnatlvF-------------------------
00438321   1/1  gfeegllgmkvGekrtltippplaYgneg.....lagktlvFeve-------------------------
00403551   1/1  gllgmkvGekrtltippelaYgneg.....lagktlvFevellev-------------------------
00449341   1/1  vipgfeegllgmkvGekrtltippplaYgneg.....lagktlvF-------------------------
00387791   1/1  gllgmkvGekrtltippplaYgeeg.....lagktlvFevellevk------------------------