[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF07717.1


[Show Plain Result]

## Summary of Sequence Search
   1::884
  10::261 8.1e-109 69.5% 0049183 00491831 1/1    II aaRS and biotin synthetases         
 262::477  2.8e-64 41.7% 0049182 00491821 1/1   ive anticodon-binding domain of alanyl- 
 562::732  1.4e-48 43.8% 0041633 00416331 1/1   /AlaRS common domain                    
 564::727    1e-45 39.8% 0042737 00427371 1/1   /AlaRS common domain                    
 566::713    2e-45 45.3% 0044651 00446511 1/1   /AlaRS common domain                    
 169::334    6e-27 32.6% 0039382 00393821 1/1    II aaRS and biotin synthetases         
   1::884


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPRRRLRPHNMKVSDIRSKFLQFFESKGHTVVRSSSLVPANDPTLLFTNSGMVQFKDVFLGTDKRPYVRA
00491831   1/1  ---------llslseireafldfFekkghtivpssplvprndptllftnAGmvqfkpvflGlveppanrl
00491821   1/1  ----------------------------------------------------------------------
00416331   1/1  ----------------------------------------------------------------------
00427371   1/1  ----------------------------------------------------------------------
00446511   1/1  ----------------------------------------------------------------------
00393821   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIQYAWELLTKVYQLPADKLWVTVYA
00491831   1/1  vssqkciragGkhnDlenVGltgrHhtfFemlGnfsfgdyfkeeaielawelltkvlgldkeklyvtvye
00491821   1/1  ----------------------------------------------------------------------
00416331   1/1  ----------------------------------------------------------------------
00427371   1/1  ----------------------------------------------------------------------
00446511   1/1  ----------------------------------------------------------------------
00393821   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EDDEAYDIWAKEVGVPADRIVRIGDNKGARYASDNFWQMADTGPCGPCSEIFYDHGPDVWGGPPGSPEED
00491831   1/1  dddealdiwllllglpeerilrlglk.......dnfwemgdtGpcGpcsEifydlgeelg.........d
00491821   1/1  ----------------------------------------------------------------------
00416331   1/1  ----------------------------------------------------------------------
00427371   1/1  ----------------------------------------------------------------------
00446511   1/1  ----------------------------------------------------------------------
00393821   1/1  ----------------------------lnfqdliltlqeyWaeqGcvilqpydvevgagtfqPatflra


                         -         -         -         +         -         -         -:280
query           GDRYIEIWNLVFMQFNRDEQGTMTPLPKPCVDTGMGLERIAAVLQHVHSNYEIDLFQALIKGAGRETHIA
00491831   1/1  gdrllEiwnlvfmqynrledgkllplplkvvDtGmGleRlaavlqgvpsny-------------------
00491821   1/1  ---------------------------------------------------dtdlflplikaiakltgle
00416331   1/1  ----------------------------------------------------------------------
00427371   1/1  ----------------------------------------------------------------------
00446511   1/1  ----------------------------------------------------------------------
00393821   1/1  lgpepwnvayvqPsirptdGrygrnpnrlqahyqfqvilkpspeniqelylkslealgidperhdirfve


                         -         *         -         -         -         -         +:350
query           DLNQNSLKVIADHIRACSFLIVDGVIPGNEGRGYVLRRIVRRAIRHGYKLGQKTPFFHKLVGDLVAQMGE
00491831   1/1  ----------------------------------------------------------------------
00491821   1/1  yddleeldvalrvlaDHiRaltfaiaDgvlPsnegrgyvlRrllRRalrllrllglkepflselvdvvie
00416331   1/1  ----------------------------------------------------------------------
00427371   1/1  ----------------------------------------------------------------------
00446511   1/1  ----------------------------------------------------------------------
00393821   1/1  dn.WegptlGaaGpgwevwldg...................lEitnlvfmq...----------------


                         -         -         -         -         *         -         -:420
query           AYPELAEAQSRVVEVLKAEEERFFETIENGMSILDAAVADLKAKGGKVLDGELAFKLHDTFGFPLDLTQD
00491831   1/1  ----------------------------------------------------------------------
00491821   1/1  ilgdvYpellenldlileiielEeerflktlekglklleklikklkkegkkvlsgedafkLydtyGlpie
00416331   1/1  ----------------------------------------------------------------------
00427371   1/1  ----------------------------------------------------------------------
00446511   1/1  ----------------------------------------------------------------------
00393821   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           VAREQEITVDEAAFDAAMTRQREQARAAGKFKMAAGLEYSGEKTVFHGYDALSMDGVRVTALYVDGASVD
00491831   1/1  ----------------------------------------------------------------------
00491821   1/1  ltvelaeelglevdldgfdelleelkerskaakkvklellpltllklleellgtefl-------------
00416331   1/1  ----------------------------------------------------------------------
00427371   1/1  ----------------------------------------------------------------------
00446511   1/1  ----------------------------------------------------------------------
00393821   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           TMQPGQSGVVVLDNTPFYAESGGQVGDQGTLVSGPAVFAVADTTKIQSDVFGHQGTLANGALKVGDTVAA
00491831   1/1  ----------------------------------------------------------------------
00491821   1/1  ----------------------------------------------------------------------
00416331   1/1  ----------------------------------------------------------------------
00427371   1/1  ----------------------------------------------------------------------
00446511   1/1  ----------------------------------------------------------------------
00393821   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           QVDAVRRARTVRNHSATHLMHKALREVLGTHVQQKGSLVDPDKTRFDFSHNAPLTDAQIRQIEEIVNAEI
00491831   1/1  ----------------------------------------------------------------------
00491821   1/1  ----------------------------------------------------------------------
00416331   1/1  -vdwdrrgllmlrHsathlLaaalrkllgdaklqigslv.edgfyyDfsldeklteeelekieklvneii
00427371   1/1  ---ddrrgllilrhsaahlLaaalkellgehvlqigslv.edgfyyDfsldkplteeelekieklmneli
00446511   1/1  -----rrlllmrlHtatHlLaaalrkllgehlvlqigsligedglrfDfslpgklteeeleeieklvnei
00393821   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           LSNAPTVAQVMPFDDAVKSGAMALFGEKYADDVRVLSIGTSKELCGGTHVTRTGDIGLFKIVVEAGVAAG
00491831   1/1  ----------------------------------------------------------------------
00491821   1/1  ----------------------------------------------------------------------
00416331   1/1  kenlpverlevsleealelfalepyklaligekyegdevrvvrigdfvdlcgGthvpntgeigafkilse
00427371   1/1  kenlpierlevsleealelfal..fgekykvelieelvedgdevrvyrigdfvdlcggthvpntgeigaf
00446511   1/1  ikenlpvevlelsreealeifgalayklelipdegeevrvvrigdfdvelcgGthvpnTgeigafkilsv
00393821   1/1  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           IRRVEAITGDNALHYLQSLDARLNEAAAALRAQPSELVPRIGQVQDQVRALEKELEKLKSKLASSQGDEL
00491831   1/1  ----------------------------------------------------------------------
00491821   1/1  ----------------------------------------------------------------------
00416331   1/1  sgaywrgdsgnrrlqriyGtaaldkl.elkey--------------------------------------
00427371   1/1  kllsvsgaywlgdsknkglqRiygvag-------------------------------------------
00446511   1/1  sgaygkglrRiya---------------------------------------------------------
00393821   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           AAQAVDVKGLKVLAAQLDGADVKTLRETMDKLKDKLQSAAIVLAAVADGKVSLIAGVTADATSKVKAGEL
00491831   1/1  ----------------------------------------------------------------------
00491821   1/1  ----------------------------------------------------------------------
00416331   1/1  ----------------------------------------------------------------------
00427371   1/1  ----------------------------------------------------------------------
00446511   1/1  ----------------------------------------------------------------------
00393821   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           VNFVAQQVGGKGGGRPDMAQAGGTDPANLPKALAGVTEWVSAKV--------------------------
00491831   1/1  ----------------------------------------------------------------------
00491821   1/1  ----------------------------------------------------------------------
00416331   1/1  ----------------------------------------------------------------------
00427371   1/1  ----------------------------------------------------------------------
00446511   1/1  ----------------------------------------------------------------------
00393821   1/1  ----------------------------------------------------------------------