[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF07787.1


[Show Plain Result]

## Summary of Sequence Search
   1::236
   1::88   9.5e-15 28.7% 0049523 00495231 1/1   domain-like                             
   8::86   1.1e-14 31.6% 0052647 00526471 1/1   domain-like                             
   8::74   1.8e-14 37.3% 0052845 00528451 1/1   domain-like                             
   9::80   1.9e-14 36.1% 0051585 00515851 1/1   domain-like                             
   8::74   2.9e-14 35.8% 0052848 00528481 1/1   domain-like                             
   5::74   5.1e-14 34.3% 0052655 00526551 1/1   domain-like                             
   9::74   6.6e-14 37.9% 0053235 00532351 1/1   domain-like                             
  10::74   7.1e-14 33.8% 0051466 00514661 1/1   domain-like                             
   1::74   7.3e-14 31.1% 0049195 00491951 1/1   domain-like                             
   8::75   8.8e-14 33.8% 0052742 00527421 1/1   domain-like                             
   8::80     1e-13 34.2% 0052798 00527981 1/1   domain-like                             
  11::81     1e-13 36.6% 0047677 00476771 1/1   domain-like                             
   7::75   1.1e-13 34.8% 0049910 00499101 1/1   domain-like                             
   9::74   1.2e-13 37.9% 0045724 00457241 1/1   domain-like                             
   6::82   1.8e-13 29.9% 0052885 00528851 1/1   domain-like                             
   8::74   1.8e-13 35.8% 0048725 00487251 1/1   domain-like                             
   9::74   1.8e-13 34.8% 0051514 00515141 1/1   domain-like                             
  10::74     2e-13 38.5% 0052830 00528301 1/1   domain-like                             
   8::74   2.2e-13 37.3% 0050079 00500791 1/1   domain-like                             
  12::74   2.3e-13 39.7% 0052877 00528771 1/1   domain-like                             
  11::74   2.6e-13 35.9% 0050188 00501881 1/1   domain-like                             
   9::74     3e-13 34.8% 0049545 00495451 1/1   domain-like                             
  11::74   3.1e-13 35.5% 0052843 00528431 1/1   domain-like                             
  12::80   3.5e-13 34.8% 0053065 00530651 1/1   domain-like                             
  11::74   4.3e-13 37.5% 0053204 00532041 1/1   domain-like                             
  10::74   5.4e-13 33.8% 0052393 00523931 1/1   domain-like                             
  10::81     8e-13 31.9% 0049392 00493921 1/1   domain-like                             
   6::70   4.2e-12 32.3% 0053096 00530961 1/1   domain-like                             
  16::80   1.6e-10 33.8% 0053202 00532021 1/1   domain-like                             
   1::236


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEAKPQAGPRRTRDRILDVSLRLFNELGEPNVTTTTIAEAMEISPGNLYYHFRNKDDIINSIFVRFEQEM
00495231   1/1  llrrrrrrrreetrerildaAlelfaekGy.gtslrdiaaaagvskgtlyyyFgsKedLllavlerller
00526471   1/1  -------rkeetrerildaalelfaekGyegtslrdiakaagvskgtlyrhFgsKedLllallerllerl
00528451   1/1  -------kkeltrerildaalelfaekGyeavtlrdiaeeagvskgtlyryFgskeeLllallerlleel
00515851   1/1  --------reltrerileaalelfaekGyeavtlrdiaeaagvskgtlYrhFkskedLllallerllerl
00528481   1/1  -------rreetrerildaalelfaekGyegtslrdiakaagvskgtlyrhFpsKedLllallerllerl
00526551   1/1  ----rdrrreetrerildaalelfaekgyegtsvrdiakaagvskgtlyrhFgsKedLllallerllerl
00532351   1/1  --------leltrerildaalelfaekgyegtslrdiaeaagvskgtlyrhFgskedLllallerllerl
00514661   1/1  ---------eetreaildaalelfaekegyeglslrdiakeagvskgtlyryFkskedLllallerllee
00491951   1/1  lmrrrrrrreetrerildaalelfaekGyegtsvrdiakaagvskgtlyryFgsKedLllallerllerl
00527421   1/1  -------rseetreaildaalelfaekgyeattvrdiaeragvskgtlyryFpskedLllallerllerl
00527981   1/1  -------kkeetrerildaAlelfaekGyegtslrdiakaagvskgtlyyyFgsKedLllavlerllerl
00476771   1/1  ----------etrerildaalelfaekGyegtslrdiakaagvskgtlyyhFgsKedLllallerllerl
00499101   1/1  ------rrreetrerildaalelfaekgyegtsvrdiakaagvskgtlyrhFgskedLllallerllerl
00457241   1/1  --------leltrerildaalelfaekgyegtslrdiaeaagvskgtlyrhFkskedLllallerllerl
00528851   1/1  -----rrrkeetrerildaalelfaekGyaatslrdiaeeagvskgtlyryFgskeeLllallerllerl
00487251   1/1  -------rreetrerildaalelfaekGyegtslrdiaeaagvskgtlyryFgsKedLllallerllerl
00515141   1/1  --------keetrerildaalelfaekGyegtslrdiakaagvskgtlyryFgskedLllallerllerl
00528301   1/1  ---------eetrerildaalelfaekgyegtsvrdiaeaagvskgtlyrhFgskedLllallerllerl
00500791   1/1  -------kreetrerildaalelfaekGyegtslrdiaeaagvskgtlyyhFpsKeaLllallerllerl
00528771   1/1  -----------trerildaalelfaekGyegtslrdiaeaagvskgtlyrhFgskedLllallerllerl
00501881   1/1  ----------etrerildaalelfaekgyegtsvrdiakaagvskgtlyryFgskedLllallerllerl
00495451   1/1  --------leetrerildaalelfaekgyegtsvrdiakaagvskgtlyryFpsKedLllallerllerl
00528431   1/1  ----------ltrerileaAlelfaekGy..lslrdiakeagvskgslyrhfkskeaLllallerlleel
00530651   1/1  -----------trerildaalelfaekGyegtslrdiakaagvskgtlyryFgsKedLllallerllerl
00532041   1/1  ----------etrerildaalelfaekgyegtslrdiakaagvskgtlyrhFgskedLllallerllerl
00523931   1/1  ---------eetrerildaalelfaekGyagtslrdiaaeagvskgtlyryFgsKedLllavlerllerl
00493921   1/1  ---------eetrerildaAlelfaekGyegtslrdiakeagvskgtlyryFpsgKedLllallerller
00530961   1/1  -----grrreetreaildaalelfaekgydatslreiakragvskgtlyrhFgskedLllallerllerl
00532021   1/1  ---------------ildaAlelfaekGyegtslrdiaeaagvskgtlyryFgsKedLllallerllerl


                         -         -         *         -         -         -         -:140
query           ERRLKMPEDHKATLGESWGYLQYMSEFLWNYRFLYRDINDLLARNRMLETNFKRIVDQKKRFALEICRQF
00495231   1/1  llaalaaaladlddpler----------------------------------------------------
00526471   1/1  laaleaaladlddple------------------------------------------------------
00528451   1/1  lell------------------------------------------------------------------
00515851   1/1  lelleealed------------------------------------------------------------
00528481   1/1  lell------------------------------------------------------------------
00526551   1/1  lell------------------------------------------------------------------
00532351   1/1  lell------------------------------------------------------------------
00514661   1/1  llel------------------------------------------------------------------
00491951   1/1  lell------------------------------------------------------------------
00527421   1/1  lelle-----------------------------------------------------------------
00527981   1/1  lelllealdd------------------------------------------------------------
00476771   1/1  lelllellddp-----------------------------------------------------------
00499101   1/1  lelle-----------------------------------------------------------------
00457241   1/1  lell------------------------------------------------------------------
00528851   1/1  laaleaalddld----------------------------------------------------------
00487251   1/1  lell------------------------------------------------------------------
00515141   1/1  lell------------------------------------------------------------------
00528301   1/1  lell------------------------------------------------------------------
00500791   1/1  lell------------------------------------------------------------------
00528771   1/1  lell------------------------------------------------------------------
00501881   1/1  lell------------------------------------------------------------------
00495451   1/1  lell------------------------------------------------------------------
00528431   1/1  lell------------------------------------------------------------------
00530651   1/1  lelllealdd------------------------------------------------------------
00532041   1/1  lell------------------------------------------------------------------
00523931   1/1  lell------------------------------------------------------------------
00493921   1/1  llelllelldd-----------------------------------------------------------
00530961   1/1  ----------------------------------------------------------------------
00532021   1/1  lelllealdd------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           QEDGDMDATPEQVDAICTNIVVIATYWLSFQFVQHPRQYNDPEQIRGYLHGSSYHIFSILAPYLRGKARE
00495231   1/1  ----------------------------------------------------------------------
00526471   1/1  ----------------------------------------------------------------------
00528451   1/1  ----------------------------------------------------------------------
00515851   1/1  ----------------------------------------------------------------------
00528481   1/1  ----------------------------------------------------------------------
00526551   1/1  ----------------------------------------------------------------------
00532351   1/1  ----------------------------------------------------------------------
00514661   1/1  ----------------------------------------------------------------------
00491951   1/1  ----------------------------------------------------------------------
00527421   1/1  ----------------------------------------------------------------------
00527981   1/1  ----------------------------------------------------------------------
00476771   1/1  ----------------------------------------------------------------------
00499101   1/1  ----------------------------------------------------------------------
00457241   1/1  ----------------------------------------------------------------------
00528851   1/1  ----------------------------------------------------------------------
00487251   1/1  ----------------------------------------------------------------------
00515141   1/1  ----------------------------------------------------------------------
00528301   1/1  ----------------------------------------------------------------------
00500791   1/1  ----------------------------------------------------------------------
00528771   1/1  ----------------------------------------------------------------------
00501881   1/1  ----------------------------------------------------------------------
00495451   1/1  ----------------------------------------------------------------------
00528431   1/1  ----------------------------------------------------------------------
00530651   1/1  ----------------------------------------------------------------------
00532041   1/1  ----------------------------------------------------------------------
00523931   1/1  ----------------------------------------------------------------------
00493921   1/1  ----------------------------------------------------------------------
00530961   1/1  ----------------------------------------------------------------------
00532021   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AFDQLAREYAAEKAAADAAKLEKDRK--------------------------------------------
00495231   1/1  ----------------------------------------------------------------------
00526471   1/1  ----------------------------------------------------------------------
00528451   1/1  ----------------------------------------------------------------------
00515851   1/1  ----------------------------------------------------------------------
00528481   1/1  ----------------------------------------------------------------------
00526551   1/1  ----------------------------------------------------------------------
00532351   1/1  ----------------------------------------------------------------------
00514661   1/1  ----------------------------------------------------------------------
00491951   1/1  ----------------------------------------------------------------------
00527421   1/1  ----------------------------------------------------------------------
00527981   1/1  ----------------------------------------------------------------------
00476771   1/1  ----------------------------------------------------------------------
00499101   1/1  ----------------------------------------------------------------------
00457241   1/1  ----------------------------------------------------------------------
00528851   1/1  ----------------------------------------------------------------------
00487251   1/1  ----------------------------------------------------------------------
00515141   1/1  ----------------------------------------------------------------------
00528301   1/1  ----------------------------------------------------------------------
00500791   1/1  ----------------------------------------------------------------------
00528771   1/1  ----------------------------------------------------------------------
00501881   1/1  ----------------------------------------------------------------------
00495451   1/1  ----------------------------------------------------------------------
00528431   1/1  ----------------------------------------------------------------------
00530651   1/1  ----------------------------------------------------------------------
00532041   1/1  ----------------------------------------------------------------------
00523931   1/1  ----------------------------------------------------------------------
00493921   1/1  ----------------------------------------------------------------------
00530961   1/1  ----------------------------------------------------------------------
00532021   1/1  ----------------------------------------------------------------------