[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF07796.1


[Show Plain Result]

## Summary of Sequence Search
   1::188
 116::183  1.7e-14 33.8% 0041987 00419871 1/1   3 and sigma4 domains of RNA polymerase  
  88::190  3.9e-14 29.3% 0039239 00392391 1/1   3 and sigma4 domains of RNA polymerase  
 113::183  4.8e-14 31.0% 0049224 00492241 1/1   3 and sigma4 domains of RNA polymerase  
 118::183  9.5e-13 27.3% 0049340 00493401 1/1   3 and sigma4 domains of RNA polymerase  
 116::190  4.7e-12 32.0% 0049695 00496951 1/1   3 and sigma4 domains of RNA polymerase  
 116::183  9.1e-12 26.5% 0051096 00510961 1/1   3 and sigma4 domains of RNA polymerase  
 129::190  6.6e-08 30.6% 0049651 00496511 1/1   3 and sigma4 domains of RNA polymerase  
   4::95   8.6e-07 20.9% 0041988 00419881 1/1   2 domain of RNA polymerase sigma factor 
   4::72   9.8e-07 20.3% 0038400 00384001 1/1   2 domain of RNA polymerase sigma factor 
 112::177  2.4e-05 26.2% 0048694 00486941 1/1   minal effector domain of the bipartite  
   1::188


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MATDQELSDFLASVERRAFKQAVFAVRDDEAALDIVQDAMIKLAEKYGDKSAAELPPLFQRILQNTIHDW
00419871   1/1  ----------------------------------------------------------------------
00392391   1/1  ----------------------------------------------------------------------
00492241   1/1  ----------------------------------------------------------------------
00493401   1/1  ----------------------------------------------------------------------
00496951   1/1  ----------------------------------------------------------------------
00510961   1/1  ----------------------------------------------------------------------
00496511   1/1  ----------------------------------------------------------------------
00419881   1/1  ---mpllseeedeellaraqkgdeeafeelverylpllyrlarrllgd.adaeDlvQevflrlwraldkf
00384001   1/1  ---eaafeellrryrprllrlalrllgdradaeDlvQetflralraldsfrgiasfraWlyriarnlaid
00486941   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FRRQKVRNTWVTLFSNLRDEREGDDSDLLDTLEAQAGTEMAESSADKVERAQVMHIIEQEIQRLPTRQRE
00419871   1/1  ---------------------------------------------eallalellllllralerLperqre
00392391   1/1  -----------------lpvgddddlelldllpd....ddapspeelleaeelrellleaLekLperere
00492241   1/1  ------------------------------------------speelleleellelllealdkLperere
00493401   1/1  -----------------------------------------------ektlelnlLldfylelLpekqre
00496951   1/1  ---------------------------------------------elleeellrelleealetLserere
00510961   1/1  ---------------------------------------------elekllelnllldfylelLtekqre
00496511   1/1  ----------------------------------------------------------eaLslLterere
00419881   1/1  dpgssfstWlyriarnlaidylrrr---------------------------------------------
00384001   1/1  ll--------------------------------------------------------------------
00486941   1/1  -----------------------------------------lllelllllllllalllaalalLtprEre


                         +         -         -         -         -         *         -:210
query           AFLMRYWEDMDVAETAAVMGCSEGSVKTHCSRATHTLAQALRARGVRL----------------------
00419871   1/1  vlllryleglsyeeiAeilgisvgtvksrlsrArkkLrellee---------------------------
00392391   1/1  vlrlryGlldlegltleeiAeilgvsrerVrqiesrAlkkLrkllrsqll--------------------
00492241   1/1  vlllryleglslkeiAeilgisvgtvksrlarAlkkLrellee---------------------------
00493401   1/1  vlelyyledlslkEIAeilgisrqaVkdllkralkkLreylek---------------------------
00496951   1/1  vlrlryGlldlegltleeiAevlgvsrerVrqiekralkkLrkalraell--------------------
00510961   1/1  vlllyyledlslkEIAeilgisrqaVkdrlkralkkLreylek---------------------------
00496511   1/1  vlrlryglddgedltleeiaellgisrervrqiekralkkLrkllrklll--------------------
00419881   1/1  ----------------------------------------------------------------------
00384001   1/1  ----------------------------------------------------------------------
00486941   1/1  vlrl.laeGlsnkeIAerlgisekTVkthlsrilrKl---------------------------------