[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF07810.1


[Show Plain Result]

## Summary of Sequence Search
   1::334
 115::301  1.9e-51 41.2% 0050040 00500401 1/1   )-binding Rossmann-fold domains         
 116::300  2.5e-51 41.0% 0050204 00502041 1/1   )-binding Rossmann-fold domains         
 116::304  1.3e-49 42.0% 0051264 00512641 1/1   )-binding Rossmann-fold domains         
 116::295  9.4e-48 41.6% 0050890 00508901 1/1   )-binding Rossmann-fold domains         
 120::302  7.7e-47 39.9% 0048799 00487991 1/1   )-binding Rossmann-fold domains         
 116::306  4.2e-46 43.4% 0050203 00502031 1/1   )-binding Rossmann-fold domains         
 116::309  1.2e-45 42.7% 0047481 00474811 1/1   )-binding Rossmann-fold domains         
 116::300  3.1e-42 43.2% 0051327 00513271 1/1   )-binding Rossmann-fold domains         
 116::301  1.4e-41 41.4% 0047655 00476551 1/1   )-binding Rossmann-fold domains         
 116::300  4.1e-41 39.2% 0046725 00467251 1/1   )-binding Rossmann-fold domains         
 115::302  6.2e-41 39.5% 0046253 00462531 1/1   )-binding Rossmann-fold domains         
   1::147  2.1e-40 46.8% 0041738 00417381 1/1   -like                                   
 116::300  3.3e-39 39.8% 0048107 00481071 1/1   )-binding Rossmann-fold domains         
 116::331  7.7e-39 33.9% 0048516 00485161 1/1   )-binding Rossmann-fold domains         
   1::156  7.8e-39 38.9% 0047480 00474801 1/1   -like                                   
 117::292  4.2e-38 36.1% 0048673 00486731 1/1   )-binding Rossmann-fold domains         
 116::302  1.1e-37 39.4% 0048863 00488631 1/1   )-binding Rossmann-fold domains         
   1::156  2.2e-35 41.1% 0050889 00508891 1/1   -like                                   
 116::290  4.2e-35 35.3% 0046114 00461141 1/1   )-binding Rossmann-fold domains         
 127::271  2.4e-33 42.4% 0039780 00397801 1/1   )-binding Rossmann-fold domains         
   1::155  3.7e-33 38.1% 0047654 00476541 1/1   -like                                   
   1::171  5.2e-33 44.4% 0049685 00496851 1/1   -like                                   
 116::300  9.7e-33 35.2% 0040551 00405511 1/1   )-binding Rossmann-fold domains         
 144::273  1.6e-32 38.5% 0042906 00429061 1/1   )-binding Rossmann-fold domains         
   1::158  2.3e-32 42.2% 0051263 00512631 1/1   -like                                   
   1::334  8.3e-32 40.7% 0046113 00461131 1/1   -like                                   
   1::158  1.6e-31 41.0% 0047994 00479941 1/1   -like                                   
   1::151  1.8e-30 39.3% 0048672 00486721 1/1   -like                                   
   1::148  8.7e-30 36.6% 0039779 00397791 1/1   -like                                   
   1::184  1.6e-29 41.8% 0046724 00467241 1/1   -like                                   
   1::140  2.7e-29 39.6% 0050202 00502021 1/1   -like                                   
   1::149    4e-29 40.7% 0048862 00488621 1/1   -like                                   
   3::151  6.6e-29 35.2% 0050001 00500011 1/1   -like                                   
   1::148    1e-28 37.4% 0040817 00408171 1/1   -like                                   
 127::278  3.7e-28 33.6% 0038711 00387111 1/1   )-binding Rossmann-fold domains         
 149::302  4.5e-28 37.9% 0043276 00432761 1/1   )-binding Rossmann-fold domains         
   1::163  3.7e-27 33.6% 0042365 00423651 1/1   -like                                   
   1::156  1.9e-26 35.5% 0043275 00432751 1/1   -like                                   
 112::325  1.3e-25 29.1% 0038567 00385671 1/1   )-binding Rossmann-fold domains         
   1::136  2.1e-25 41.9% 0042905 00429051 1/1   -like                                   
 113::300  6.6e-24 25.4% 0038379 00383791 1/1   )-binding Rossmann-fold domains         
 148::292  3.9e-23 31.9% 0036746 00367461 1/1   )-binding Rossmann-fold domains         
 123::276  4.3e-22 31.0% 0036744 00367441 1/1   )-binding Rossmann-fold domains         
   1::168  8.6e-20 32.5% 0038267 00382671 1/1   -like                                   
 117::293  4.8e-19 26.3% 0042366 00423661 1/1   )-binding Rossmann-fold domains         
 113::301  1.5e-17 28.7% 0044526 00445261 1/1   )-binding Rossmann-fold domains         
 121::271  5.2e-17 24.3% 0049686 00496861 1/1   )-binding Rossmann-fold domains         
   1::156  4.5e-16 32.9% 0045092 00450921 1/1   -like                                   
 116::300  6.6e-15 23.9% 0047059 00470591 1/1   )-binding Rossmann-fold domains         
   2::143  4.8e-14 39.0% 0047104 00471041 1/1   -like                                   
   7::136  5.5e-14 30.2% 0044605 00446051 1/1   -like                                   
   1::161  2.1e-12 34.9% 0046449 00464491 1/1   -like                                   
   1::109  3.4e-12 38.4% 0047232 00472321 1/1   -like                                   
   1::151  6.3e-12 31.5% 0046314 00463141 1/1   -like                                   
 113::251  9.6e-12 27.7% 0037437 00374371 1/1   )-binding Rossmann-fold domains         
   1::109  2.6e-11 39.4% 0047181 00471811 1/1   -like                                   
   1::134  2.1e-10 34.7% 0046252 00462521 1/1   -like                                   
   1::136  6.2e-10 33.3% 0047235 00472351 1/1   -like                                   
 116::248  5.7e-09 26.4% 0042340 00423401 1/1   )-binding Rossmann-fold domains         
 148::247  2.3e-07 27.0% 0038559 00385591 1/1   )-binding Rossmann-fold domains         
 148::317  1.4e-06 20.7% 0048469 00484691 1/1   )-binding Rossmann-fold domains         
 150::268    2e-05 22.9% 0042180 00421801 1/1   )-binding Rossmann-fold domains         
   1::132  6.2e-05 34.7% 0047846 00478461 1/1   -like                                   
 150::229  9.5e-05 19.2% 0042429 00424291 1/1   )-binding Rossmann-fold domains         
 153::247  0.00032 25.5% 0042207 00422071 1/1   )-binding Rossmann-fold domains         
 152::306  0.00034 21.3% 0048454 00484541 1/1   )-binding Rossmann-fold domains         
 127::188  0.00075 19.4% 0048035 00480351 1/1   )-binding Rossmann-fold domains         
   1::334


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKAIEIREYGAPEVLQETQRPDPEPKAGEILIRVAAAGINRPDVFQRTGNYPVPPGASDLPGLEVAGVVV
00500401   1/1  ----------------------------------------------------------------------
00502041   1/1  ----------------------------------------------------------------------
00512641   1/1  ----------------------------------------------------------------------
00508901   1/1  ----------------------------------------------------------------------
00487991   1/1  ----------------------------------------------------------------------
00502031   1/1  ----------------------------------------------------------------------
00474811   1/1  ----------------------------------------------------------------------
00513271   1/1  ----------------------------------------------------------------------
00476551   1/1  ----------------------------------------------------------------------
00467251   1/1  ----------------------------------------------------------------------
00462531   1/1  ----------------------------------------------------------------------
00417381   1/1  mkalvldelggpevlelvelplpelgpgevlvkvhaaglnykDllartglypvvpglplvpGlefaGvvv
00481071   1/1  ----------------------------------------------------------------------
00485161   1/1  ----------------------------------------------------------------------
00474801   1/1  mkalvltgpgdp..leleevplpepgpgevlvkvlaaglngsDllillglyplllelplvlGhEaaGvVv
00486731   1/1  ----------------------------------------------------------------------
00488631   1/1  ----------------------------------------------------------------------
00508891   1/1  petmkalvltgpggpevleleevplpepgpgevlvkvlaaglnpsDllillglyplvlplplvlgheaaG
00461141   1/1  ----------------------------------------------------------------------
00397801   1/1  ----------------------------------------------------------------------
00476541   1/1  Mkalvltgpgd...leleevplpepgpgevlvkvlaagingsDlhlirlglyplll..plvlGhEaaGvV
00496851   1/1  sktmkalvltgpgdpevleleevplpepgpgevlvkvlaaglnpsDllilrglyplvvplplvlGhegaG
00405511   1/1  ----------------------------------------------------------------------
00429061   1/1  ----------------------------------------------------------------------
00512631   1/1  etmkalvltgpggpevlelelevplpepgpgevlvkvlaaglnpsDllilsglyplvpplplvlghegaG
00461131   1/1  lllslpltmkaavltgpggp..leleevpvpepgpgevlvkvlaagicgsDllhirrglyplplPl..vl
00479941   1/1  smpltmkalvltgpgdp..leleevplpepgpgevlvkvlaagingsDlhillglyplplklplvlGhEg
00486721   1/1  mtlslpltmkalvltgpgdp..leleevpvpepgpgeVlvkvlaagicgsDlhilrglypvplpl..vlG
00397791   1/1  mkAavltgpgdp..leleevpvpepgpgeVlvkvlaagicgsDlhilrglyplllllllllvklplvlGh
00467241   1/1  mstmkalvltgpgdp..leleevpvpepgpgeVlvkvlaagingsDlhilrglypvplpl..vlGhEgaG
00502021   1/1  lpltmkalvltgpgdp..leleevpvpepgpgeVlvkvlaagingsDlhirrglypvlp.lplvlGhEga
00488621   1/1  ltlsllmkamkalvlggpgpleleevpvpepgpgevlvkvlaagingsDlhirrglypvp.klplvlGhE
00500011   1/1  --mkaavvlggpgpleleevplpepgpgevlvkvlaagicgsDlhilrglyp.llklplvlGhEaaGvVv
00408171   1/1  lslvitmkAavltgpggp..leleevpvpepgpgeVlvkvlaagicgtDlhilrglypl.vklplvlGhE
00387111   1/1  ----------------------------------------------------------------------
00432761   1/1  ----------------------------------------------------------------------
00423651   1/1  aaalpltmkalvltgpg...pleleevpvpepgpgevlvkvlatgicgtDlhilkgglplalvlklplvl
00432751   1/1  mkAlvltgpgdp..leleevpvpepgpgevlvkvlaagicgtDlhiyrgglpllvklplvlGhEaaGvVv
00385671   1/1  ----------------------------------------------------------------------
00429051   1/1  mkAlvlygagdpevlrleevplpepgpgevlvkvkavgingtDlkilsggyp.vlklplilGhEaaGvVe
00383791   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00367441   1/1  ----------------------------------------------------------------------
00382671   1/1  lilmkAvvvlatgdPkevlflkveeiplpalgpgevlvkviaagicgtDlailqgvyptkpvktignptg
00423661   1/1  ----------------------------------------------------------------------
00445261   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00450921   1/1  mkallllglgk...lellevpePepgPgevlvrtlavgvcgtDlhvldgdlpg.velgiilGheivGeVv
00470591   1/1  ----------------------------------------------------------------------
00471041   1/1  -kAavllgpgdplrled..vpvpelpgpgevlvkvaaagiCgtDlhilegllpglllvklPlvlGhEiaG
00446051   1/1  ------mvtnkqivlakrpegfPkpedfeleevplpepgdgevlvkvlylsv...DPymrgrmypvelg.
00464491   1/1  kmkAlvllgpg...dlrleevpvpepgpgevlvkvaatgiCgsDlhlykhgdlgdllvklPlvlGHEiaG
00472321   1/1  stagkvikmkAavlrgagkpleieevelpep..gpgeVlvkvvatGiCgtDlhvldgllpvp..lPlvlG
00463141   1/1  stagkvikmkAavlreagkpleieevelpep..gpgevlvkvvatGiChtDlhvldgalpvplPl..vlG
00374371   1/1  ----------------------------------------------------------------------
00471811   1/1  stlgkvikmkAavlrgpgkp..leieevelpepgpgeVlvkvvatGiChsDlhvldgllpvp..lPvvlG
00462521   1/1  stagkvikmkAavlrepgkp..leieevelpepgpgeVlvkvvatGvChtDlhvldgalpvp..lPvvlG
00472351   1/1  stagkvikmkAavllgpgkpleieevelpep..gpgeVlvkvvatGiChsDlhvldgelpvp..lPlvlG
00423401   1/1  ----------------------------------------------------------------------
00385591   1/1  ----------------------------------------------------------------------
00484691   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00478461   1/1  tmkavvylgpgk...veveevplPelegpggkklegdvivkvtatgiCgsDlhilrgllpvelp..lvlG
00424291   1/1  ----------------------------------------------------------------------
00422071   1/1  ----------------------------------------------------------------------
00484541   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GGDLSHPANRFGLKAGDRVCALVQGGGYAELCTAPIEQCLPVPEGLTDIEAAALPETFFTVWSNVFDRGQ
00500401   1/1  --------------------------------------------glsleeaAalglaglTAylallelak
00502041   1/1  ---------------------------------------------lsleeaaalplaglTAylallelag
00512641   1/1  ---------------------------------------------lsleeaAalplagltAylalvelag
00508901   1/1  ---------------------------------------------lsleeaAalplaglTAylalfalle
00487991   1/1  -------------------------------------------------eeAAalplagltaylalvera
00502031   1/1  ---------------------------------------------lsleeaAalpeagltayhalverag
00474811   1/1  ---------------------------------------------lsleeaAalplagltAylalv.rag
00513271   1/1  ---------------------------------------------lsleeaAalpealltayhalvr.ag
00476551   1/1  ---------------------------------------------lsleeaaalpeplltayhal.rlag
00467251   1/1  ---------------------------------------------lsleeaaallealltayhalvrrag
00462531   1/1  --------------------------------------------glsleeaalllcalltayhalvrrag
00417381   1/1  avgeg......gfkvGdrVvalglglgetldGglaeyvvvpadllvplPdglsleeAaalptaglTAyla
00481071   1/1  ---------------------------------------------lpleeaaallcplltayhallrrag
00485161   1/1  ---------------------------------------------lsleeaAalplagltaylallllld
00474801   1/1  ...............GdrVvvllldggfaeyvvvpadllvklPdglsleeaaalplalgltaylallela
00486731   1/1  ----------------------------------------------pleeaaallcalltayhalvrrag
00488631   1/1  ---------------------------------------------lsleeaAallcagltayhalv.rag
00508891   1/1  vVvevgsg......gfkvGdrVvvlllvlgllldGgfaeyvvvpadllvklPdg.sleeaaavlplagl.
00461141   1/1  ---------------------------------------------lpleeaaallcalatayhalvrrag
00397801   1/1  --------------------------------------------------------Caltvayaalkrag
00476541   1/1  vevGsgvt......gfkvGdrVvvlpvlscgeceaclsglenlcenllfglllgllldGgfaeyvvvpla
00496851   1/1  vVvevgsg......gfkvGdrVvvlplvlgllrdGgfaeyvvvpadllvklPdglsleeaa.........
00405511   1/1  ---------------------------------------------lsleeaaallcagltayhallr.ag
00429061   1/1  ----------------------------------------------------------------------
00512631   1/1  vVvevGsgvt......gfkvGdrVvvlllldggfaeyvvvpadllvklpdgllsleeaaalpl.......
00461131   1/1  GhEgaGvVvevGsgvt......gfkvGdrVvvlpviscgeceaclsglenlcenllvlglagllldgtlr
00479941   1/1  aGvVvevGsgvt......gfkvGdrVvvlplvgscgeceaclsglenlcenllllgllldGgfaeyvvvp
00486721   1/1  hEgaGvVvevGsgvt......gfkvGDrVvvlflvscgeceaclsglenlcenlvlglggglllggttrl
00397791   1/1  EaaGvVvevGsgvt....gfkvGdrVvvlpllscgecraclsglenlcenllflgllldggfaeyvvvpa
00467241   1/1  vVvevGsgvt......gfkvGDrVvglfiscgeceaclaglenlcenllllglggdlldgtlllsllgls
00502021   1/1  GvVvevlGsgvtgdls..lfkvGdrVvglpviscgeceacllsglenlcpnllllglngglllgllldGg
00488621   1/1  aaGvVve....vGsgvdtgfkvGdrVvvlplvpscgeceaclsglenlcenllllllgllllgltldGgf
00500011   1/1  avGsgvt......glkvGdrVvvlplviscgeceacrsglenlcenllllglagllllgllldGgfaeyv
00408171   1/1  aaGvVvevGsgvt......gfkvGdrVvvlpliscgeCraclsgrpnlcenlrllnlkgllldgtlrlsl
00387111   1/1  --------------------------------------------------------pgltAyvglleiak
00432761   1/1  ----------------------------------------------------------------------
00423651   1/1  GhEavGvVvevGsgvt....glkvGdrVvvlpllscgecpyclagrynlcegllflgvlgldGgfaeyvv
00432751   1/1  evGsgvtg......lkvGdrVvvlplliscgecryclsglpnlcenllflgvlldGgfaeyvvvpaanlv
00385671   1/1  -----------------------------------------lple....llallGcglltaliglvevak
00429051   1/1  evGsgvt......glkvGDrVvvllcgdgglaeyvvvdedllvklPeslsllevleaaallvallt----
00383791   1/1  ------------------------------------------pkdvdlrvllllpeigltalealkrall
00367461   1/1  ----------------------------------------------------------------------
00367441   1/1  ----------------------------------------------------llglafgtgfllllela.
00382671   1/1  elpvvlGhEavgvVi....avGsnVsslkpGDrVvpivvsdgalaeyavvdenaliklpdel....aall
00423661   1/1  ----------------------------------------------lplelgalvltlatavralllagv
00445261   1/1  ------------------------------------------pkslpllelallltglltawlplll.ag
00496861   1/1  --------------------------------------------------Aasilllgltsylallevlk
00450921   1/1  evGsnve......glkvGdrVvvpallscgtclycrrgllnlcddlllgellglgrdGafaeyvlvpaad
00470591   1/1  ---------------------------------------------ldllqaatllvnPltAyllltdfvd
00471041   1/1  vve....evGegvtglkvGdrvvvllllscgtCraCraglenlCenllllGllldGgfaeyvvvparllv
00446051   1/1  evmvgggvgevve.......sgvpgfkvGdlVvgl...ggwaeyavvdadlllklpdllaeglklk----
00464491   1/1  vVvevGsgvt......glkvGdrVvveplvscgeceycrrgrynlcenllflglppldGgfaeyvvvpaa
00472321   1/1  HEgaGiVeevGegVtd......lkpGDrVvllfiisCge-------------------------------
00463141   1/1  HEgaGiVeevGegVtdlkvGdrVvllfllsCgeCryCrsglenlCenlgvlvllgvlldgtlrfyl.vgg
00374371   1/1  ------------------------------------------agrlavleaalllervltglgal.....
00471811   1/1  HEgaGvVeevGegVtg......vkvGDrVvllflpscge-------------------------------
00462521   1/1  hEgaGvveevGegVtg......vkpGdrVvllfllscgeCryClsgrenlCenlglngvgllgd------
00472351   1/1  HEgaGiVeevGegVtg......lkvGdrVvllflisCgeCryClsglenlCenlralgllgvlggg----
00423401   1/1  ---------------------------------------------aGylavllaalllcrflgglglllt
00385591   1/1  ----------------------------------------------------------------------
00484691   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00478461   1/1  HEfvGeVvevGsdvtn......lkvGdrVvvpflisCgeCryCkagltslCenlnlglagal--------
00424291   1/1  ----------------------------------------------------------------------
00422071   1/1  ----------------------------------------------------------------------
00484541   1/1  ----------------------------------------------------------------------
00480351   1/1  --------------------------------------------------------gllldtallvllll


                         +         -         -         -         -         *         -:210
query           LGKGPRGAAETLLIQGGSSGIGTTAIQIAKALGFKVFVTAGSDDKCKACESLGADRAINYKTQDFVAEVK
00500401   1/1  lkpg.....etvlvhgAaGgvGsaaiqlakalGarviatagsdeklellkelGadhvinykeedfveevl
00502041   1/1  lkls...pgetvlvhGAaGgVGllavqlAkalGasrViatagseeklellvkelGadevinykeedlvea
00512641   1/1  lkpge.....tVlvhGAaGgvGlaavqlAkalGarViatagseeklelakelGadhvidyrdedlveavk
00508901   1/1  raglkpge.....tvlvtGAaGgvGslavqlAkalGarViatagseeklellrelGadevidyk..dlve
00487991   1/1  glkpg.....etVlvtgaaGgvGlaavqlAkalGarviatagseeklelakelGadhvinykdedfveav
00502031   1/1  lkpgd.....tVlvlGa.GgvGllavqlakalGasrViatdrspeklelakelGadhvinykdedlldlv
00474811   1/1  lkpgd.....tVlvtGAaGgvGlaavqlakalGarViatdrspeklelakelGadhvidyrdedl.....
00513271   1/1  lkpgd.....tVlviGa.GgvGllaiqlakalGagrViatdispeklelakelGadhvinyrdedlveav
00476551   1/1  vkpgd.....tVlvlGa.GgvGllavqlAkalGasrViavdgspeklelakelGadhvinykdedlveav
00467251   1/1  v.....kpgdtVlvlGa.GgvGllaiqlAkalgasrViavdlseeklelakelGadhvinykdedlveav
00462531   1/1  vkpg.....dtVlvlGa.GgvGllavqlAkalGasrViavdlseeklelakelGadhvinykdledlvea
00417381   1/1  Lvalarl---------------------------------------------------------------
00481071   1/1  vkpgd.....tVlvlGa.GgvGllavqlAkalGasrviavdlsdeklelakelGadhvinykdededlve
00485161   1/1  lagllpg.....ktvlvtGAaggiGsaaaqllaalGarViavdrseeklellkelgadvvidvtdedave
00474801   1/1  glkp........vlvl------------------------------------------------------
00486731   1/1  vkpgd.....tVlvlGa.GgvGllavqlAkalGasrViavdlseeklelakelGadevinykdedkdlve
00488631   1/1  vk.....pgdtVlviGa.GgvGllavqlAkalGarViavdrseeklelakelGadhvidykeedlvaell
00508891   1/1  .ylallralggllk.g------------------------------------------------------
00461141   1/1  vkpgd.....tVlvlGa.GgvGllavqlAkalgasrviavdlspeklelakelGadhvinpkdededlve
00397801   1/1  lkpg.....dtvlvvGaaGgvGllavqlakalgaarviavdlsdeklelakelgadhvinskeedlveev
00476541   1/1  adllvklPldglsle-------------------------------------------------------
00496851   1/1  ...............................---------------------------------------
00405511   1/1  llpgk.....tvlvtGa.GgvGlaaaqlaaalGarViavdrseeklelarelgadvvidvtdedlveavl
00429061   1/1  ---aklkpgktvlvtGAaggvGlaaaqlakalGarViatarseeklellkelGadvvidykdedlvealk
00512631   1/1  .........agllkpget----------------------------------------------------
00461131   1/1  lllggkslltldGlsgfaeyvvvparllvkilPdglslee..............................
00479941   1/1  adllvklPdg........----------------------------------------------------
00486721   1/1  llggkpllgfl-----------------------------------------------------------
00397791   1/1  allvklpd--------------------------------------------------------------
00467241   1/1  lllglllglGgfaeyvvvpadllvkllPdglsleea........--------------------------
00502021   1/1  ----------------------------------------------------------------------
00488621   1/1  aeyvvvpad-------------------------------------------------------------
00500011   1/1  vvparnlvklP-----------------------------------------------------------
00408171   1/1  gglllggv--------------------------------------------------------------
00387111   1/1  vkpge.....tVlvlGa.GgvGllavqlaklaGagrviavdgsdeklelakelGadavvnykdledlaea
00432761   1/1  --------lplelaaalglalltavlavlaagvkpgktvlvlGa.GgvGlaaaqlakalGakVvavdise
00423651   1/1  vpaanlvklpdglsleeaallep-----------------------------------------------
00432751   1/1  klpdglslelaallep------------------------------------------------------
00385671   1/1  lkpGk.....tvlvlGl.GgvGllalllakaaGagrvigvdindeklelakelGathvvnyketekvaee
00429051   1/1  ----------------------------------------------------------------------
00383791   1/1  elkpgs.....rVlviGa.GgvGsaaaqllaaaGvgkvilvDrdeealerarrlgpdvvvdpie.dlaea
00367461   1/1  -------lellsvalhallraglvpGktVlviGa.GgiGlaaalaakalGakViatdrspekleqakelg
00367441   1/1  ....gvlpgktVlvfGl.GgvGlaaillakaaGagrviavdlndeklelakslGadlvvnpkdldeevae
00382671   1/1  tlaaltalkaireletlydlllslgrlv------------------------------------------
00423661   1/1  ......lpgakVlvlGa.GvvGlqaaalakalGageVtvvDisperleqaeelGadlvvvpseedlaeav
00445261   1/1  llpg.....ktvgviGl.GgiGlavarlakalGarViaydrspeklelakelgadfvvvysdedsleel.
00496861   1/1  ikegk.....kVlvtGAtGgiGlavvrlllkrGykViaidrseekleklkelgadvvldvt..dveellk
00450921   1/1  aflvklPdelddeaaa------------------------------------------------------
00470591   1/1  lkpG....ndwviqnaansavGklviqlakllGlktinvvrdrpdleelvdeLkalGadvviteeellde
00471041   1/1  klp-------------------------------------------------------------------
00446051   1/1  ----------------------------------------------------------------------
00464491   1/1  llvklPdglslelaallepll-------------------------------------------------
00472321   1/1  ----------------------------------------------------------------------
00463141   1/1  pvlhflglssf-----------------------------------------------------------
00374371   1/1  ...agllpgkrvlViGa.GgiGleaAaalarlGakVtvvdrrpellerleelgakfvlltldeelvevvl
00471811   1/1  ----------------------------------------------------------------------
00462521   1/1  ----------------------------------------------------------------------
00472351   1/1  ----------------------------------------------------------------------
00423401   1/1  lagglag.....kkvlviGa.GgvGlaaarllaalGakVtvldrnpekleqleelgadavevdvsdtadl
00385591   1/1  -------egkvvLVtGgsggiGraiaralaaaGarVvvvdrseealgggvlavaaDvtdeeavaalvaaa
00484691   1/1  -------DgigavsllkrlgvdlpgkrvlviGa.Ggagraaalallalgaevtvvnrtlekaeelaella
00421801   1/1  ---------DgigavsllkrllvdlpgkkvlvlGaG.giGralalalaaagaevvvvnrtlekaeelaee
00478461   1/1  ----------------------------------------------------------------------
00424291   1/1  ---------mmlslkgkvvlvtGasggiGralaralaaaGarVvlldrseekleelaaelgrvlavvlDv
00422071   1/1  ------------givGAtGrvGrllvrlllahpgvevvavvsraeaaellkllgadvvvdatppdvlael
00484541   1/1  -----------mmkklkvaiiGa.GniGlalarallalaggaevvavadrdpekaglalakelgatttvn
00480351   1/1  llllldlkgkvalVtGasggiGlaiAralaaaGarVvladrneeklea----------------------


                         -         -         -         +         -         -         -:280
query           ALTEGKGVDVILDMVAGSYLARELSCIADDGRIVIIALLGGGKAEIPLGDILRRRITITGSTLRPRPASF
00500401   1/1  eltggegvdvvldnvggetleaslkllapgGrivviGlasgynlelpvlplllkgltllgillgsrllvl
00502041   1/1  lkeltgg.gvdvvldtvggetleaaldalapgGrivliglasgyvleldlllllllllllllllkgltll
00512641   1/1  eltggrgvdvvldtvggetleaaldllapgGrlvlvgllsg..lpldllllllkgltllgsllgtll...
00508901   1/1  evleltggegvdvvldtvggetleaalallapgGrvvligllsgaplpldllplllkgltllgsllgtrl
00487991   1/1  leltggrgvdvvldavggetleaaldllapgGrvvlvGlasgailplpllllllkgltllgsllgsrldl
00502031   1/1  eavkeltggrgvdvvldavggpatleaalellrpgGrlvlvgvlsgpllllplpllllllkgltlvgsll
00474811   1/1  altggggvdvvldtvgg.tleaaldllrpgGrlvlvgllsggplplpllllllkgltllgsllgs.....
00513271   1/1  leltggrgvdvvidavggeatleaalellkpgGrivlvgvlgggnllelplpllllllkgltlvgsllgt
00476551   1/1  leltggrgvdvvldavggeatleaalellrpgGrivlvgvlggglllplplpllllllkeltllgsllg.
00467251   1/1  keltgg.gvdvvldavggpatleaalealrpgGrlvlvGvlggplllpldllllllkeltllgsllggr.
00462531   1/1  vkeltggrgvdvvidavggeatleaalelllrpgGrivlvGvpggpllplpllllllkgltilgslvgg.
00417381   1/1  ----------------------------------------------------------------------
00481071   1/1  avkeltgg.gvdvvldavggpatleaalellrpglGrivlvGvpggplpllpllllllkeltllgslvgg
00485161   1/1  al....agggvdvvvnnaggatlgallellapggrvvlvnllggllltral...................
00474801   1/1  ----------------------------------------------------------------------
00486731   1/1  avkeltgg.gvdvvldavggpatleqalellrpglGrvvlvGvpggplpllpllllllkgltllgslvgs
00488631   1/1  ....gggvdvvldtvggpleltleaalellrpgGrlvlvGlp.ggplpldllllllkgltilgslvgsr.
00508891   1/1  ----------------------------------------------------------------------
00461141   1/1  avkeltgg.gvdvvleavgapaaleqalellrpggGrvvlvGvpggplp.lpllllllkeltllgslvgg
00397801   1/1  leltggrgvdvvldavgaeatlelaldllapgGrlvlvGllgg.lleldllllllkeltil---------
00476541   1/1  ----------------------------------------------------------------------
00496851   1/1  ----------------------------------------------------------------------
00405511   1/1  elt.g.gvDvvvdaagvpatleealrllkpggrlvlvgvagg.llpldlarlllkgvnlrgsflgtr...
00429061   1/1  eltggrgvdvvlnnvggetldaaldllapggrvvlvglisgynlpllllllllkgltllgfll-------
00512631   1/1  ----------------------------------------------------------------------
00461131   1/1  ......................................................................
00479941   1/1  ----------------------------------------------------------------------
00486721   1/1  ----------------------------------------------------------------------
00397791   1/1  ----------------------------------------------------------------------
00467241   1/1  ----------------------------------------------------------------------
00502021   1/1  ----------------------------------------------------------------------
00488621   1/1  ----------------------------------------------------------------------
00500011   1/1  ----------------------------------------------------------------------
00408171   1/1  ----------------------------------------------------------------------
00387111   1/1  lkeltggegvdvvldnvggeeallaalrlllkpgGrvvlvGvisgyvlplpllelllkrltlrgfivg--
00432761   1/1  eklelakelGadfvvvykdedvaeavleltg..gadvvidtagipgilreilrllkpggvivllgllpg.
00423651   1/1  ----------------------------------------------------------------------
00432751   1/1  ----------------------------------------------------------------------
00385671   1/1  vkeltdgegvdvvieavgspqtlreaisvlkkpgGtvvlvgvpsgplellpivllvlssktvrgslvggr
00429051   1/1  ----------------------------------------------------------------------
00383791   1/1  llellggrgvDlvldcvdnfetlallidalkpggipvvsgagag..gqldpteillkglsvrglfvlpr.
00367461   1/1  adfvvvykdlsediieavaellatngggadividtagipgileeavdllkpggvivdvgladg.eltvpl
00367441   1/1  avleltgg.gvdvvveavgsvqallqaidavrpgwGtvvlvGllgk.elelplv.lvlngltlrGs----
00382671   1/1  ----------------------------------------------------------------------
00423661   1/1  reltgkqgggaDlvitaagipgvlrealevmkpggvvvdvaidqg.eltlplttlvlkgvtvvgsvvl..
00445261   1/1  ....lkgaDvvilhvpltlaleevlellkpggvvvdlgaltgglinaevlalmkkgatlintarggl...
00496861   1/1  allklggvdvvihtagapvtelslsllkqllrvnvlgtlnllrallpllvklgvkrivyis---------
00450921   1/1  ----------------------------------------------------------------------
00470591   1/1  dlkkllkeltkgggeevklalnavGGksatallrlLspggllvtyGglskepvtlptsllifkdltlrGf
00471041   1/1  ----------------------------------------------------------------------
00446051   1/1  ----------------------------------------------------------------------
00464491   1/1  ----------------------------------------------------------------------
00472321   1/1  ----------------------------------------------------------------------
00463141   1/1  ----------------------------------------------------------------------
00374371   1/1  altvdvsdeegrlkavetleellgeaDvvivaagippatap-----------------------------
00471811   1/1  ----------------------------------------------------------------------
00462521   1/1  ----------------------------------------------------------------------
00472351   1/1  ----------------------------------------------------------------------
00423401   1/1  eelva......eaDvvinaagipgatapllvtrellel--------------------------------
00385591   1/1  vellefggldvlvnnagilavgeplldlsledwdrvl---------------------------------
00484691   1/1  devvaldlddleeal......ggaDlvinatgagmaglvlplllsllkpggvvvdvgypplitpllalar
00421801   1/1  lga..qgdvsdleeleeal.....ggaDivvnatgaglpglllelllellkpggvvvd------------
00478461   1/1  ----------------------------------------------------------------------
00424291   1/1  tdeesveaaveel..ggld---------------------------------------------------
00422071   1/1  aeallkagvdaVils.aGfrlsdlllvellydaaggv---------------------------------
00484541   1/1  .....avddleelladpgvDvvieatpagahaevalaaleagkhvvvekptaltveeavvplvelvelae
00480351   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KGAIAQALHQNVWPLLASGKIKPVIHKVFPAAQAADAHRLMESSEHIGKIVLTW----------------
00500401   1/1  dlllllelalelllllleegk-------------------------------------------------
00502041   1/1  gfllgslpellr.....eal--------------------------------------------------
00512641   1/1  .....lelleelldllaegklkpv----------------------------------------------
00508901   1/1  lllelllllllglll-------------------------------------------------------
00487991   1/1  rellllvalgkilplvlithll------------------------------------------------
00502031   1/1  gtr..........edleelldllasg--------------------------------------------
00474811   1/1  ......rlleelldllaegklkpvilitf-----------------------------------------
00513271   1/1  ra.........elleealdl--------------------------------------------------
00476551   1/1  .........tredlpellell-------------------------------------------------
00467251   1/1  ......lpleelpellelll--------------------------------------------------
00462531   1/1  .........redlpelldllas------------------------------------------------
00417381   1/1  ----------------------------------------------------------------------
00481071   1/1  r.......lvleelpellel--------------------------------------------------
00485161   1/1  ..............lplllkrgkgrivnsskaalegltealalelagkgig-------------------
00474801   1/1  ----------------------------------------------------------------------
00486731   1/1  raprdlpelldl----------------------------------------------------------
00488631   1/1  .........adleelldlvaeg------------------------------------------------
00508891   1/1  ----------------------------------------------------------------------
00461141   1/1  rrdleellel------------------------------------------------------------
00397801   1/1  ----------------------------------------------------------------------
00476541   1/1  ----------------------------------------------------------------------
00496851   1/1  ----------------------------------------------------------------------
00405511   1/1  .......aalpellellagg--------------------------------------------------
00429061   1/1  ----------------------------------------------------------------------
00512631   1/1  ----------------------------------------------------------------------
00461131   1/1  ......................................................----------------
00479941   1/1  ----------------------------------------------------------------------
00486721   1/1  ----------------------------------------------------------------------
00397791   1/1  ----------------------------------------------------------------------
00467241   1/1  ----------------------------------------------------------------------
00502021   1/1  ----------------------------------------------------------------------
00488621   1/1  ----------------------------------------------------------------------
00500011   1/1  ----------------------------------------------------------------------
00408171   1/1  ----------------------------------------------------------------------
00387111   1/1  ----------------------------------------------------------------------
00432761   1/1  plplpladlllkgvtiigslvg------------------------------------------------
00423651   1/1  ----------------------------------------------------------------------
00432751   1/1  ----------------------------------------------------------------------
00385671   1/1  ................................vpleelpealkrl-------------------------
00429051   1/1  ----------------------------------------------------------------------
00383791   1/1  .........edleellelll--------------------------------------------------
00367461   1/1  llvllkgvtivg----------------------------------------------------------
00367441   1/1  ----------------------------------------------------------------------
00382671   1/1  ----------------------------------------------------------------------
00423661   1/1  vanlpgavdllas---------------------------------------------------------
00445261   1/1  .......vdeeallealasgk-------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00450921   1/1  ----------------------------------------------------------------------
00470591   1/1  wltkwlke.dpeekldtlde--------------------------------------------------
00471041   1/1  ----------------------------------------------------------------------
00446051   1/1  ----------------------------------------------------------------------
00464491   1/1  ----------------------------------------------------------------------
00472321   1/1  ----------------------------------------------------------------------
00463141   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00471811   1/1  ----------------------------------------------------------------------
00462521   1/1  ----------------------------------------------------------------------
00472351   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00385591   1/1  ----------------------------------------------------------------------
00484691   1/1  avglrltvdgl.............emlveqaalafel---------------------------------
00421801   1/1  ----------------------------------------------------------------------
00478461   1/1  ----------------------------------------------------------------------
00424291   1/1  ----------------------------------------------------------------------
00422071   1/1  ----------------------------------------------------------------------
00484541   1/1  ekgvvlgvgfgv........rflppv--------------------------------------------
00480351   1/1  ----------------------------------------------------------------------