[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF07859.1


[Show Plain Result]

## Summary of Sequence Search
   1::259
   1::259  7.8e-76 37.1% 0050444 00504441 1/1   crotonase                               
   1::258  4.4e-75 36.6% 0052793 00527931 1/1   crotonase                               
   5::260  5.6e-71 37.1% 0046300 00463001 1/1   crotonase                               
   1::259  6.8e-71 37.6% 0048890 00488901 1/1   crotonase                               
   5::258  1.3e-70 37.2% 0044384 00443841 1/1   crotonase                               
   1::261  1.3e-69 37.2% 0038805 00388051 1/1   crotonase                               
   2::261  2.4e-69 35.3% 0052487 00524871 1/1   crotonase                               
   1::259  1.3e-68 36.7% 0048476 00484761 1/1   crotonase                               
   1::245  6.4e-68 35.7% 0052608 00526081 1/1   crotonase                               
   5::259  8.4e-68 37.2% 0050758 00507581 1/1   crotonase                               
   1::255  1.5e-67 37.1% 0051137 00511371 1/1   crotonase                               
   1::261  2.1e-67 37.9% 0036954 00369541 1/1   crotonase                               
   2::249  7.4e-67 37.9% 0038654 00386541 1/1   crotonase                               
   5::242  3.9e-64 36.2% 0048518 00485181 1/1   crotonase                               
   1::260  8.8e-64 37.0% 0049386 00493861 1/1   crotonase                               
   4::235  1.2e-58 36.2% 0051719 00517191 1/1   crotonase                               
  98::205  5.5e-14 33.3% 0041933 00419331 1/1   crotonase                               
  22::203  7.2e-12 21.8% 0041934 00419341 1/1   crotonase                               
   1::187    3e-09 22.8% 0052142 00521421 1/1   crotonase                               
  83::214  1.6e-08 18.9% 0051041 00510411 1/1   crotonase                               
   1::188  6.8e-07 21.7% 0044160 00441601 1/1   crotonase                               
  95::187  6.2e-05 24.7% 0051228 00512281 1/1   crotonase                               
 100::214  0.00091 26.7% 0052628 00526281 1/1   crotonase                               
   1::259


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTAQLLSERVDSTLVLTISNPEARNALHPDIYAASAEALEVAARDDSIRAVILTGADGVFCAGGNLNRLL
00504441   1/1  mmmsyetvlvevledgvatitlnrpdeklNalslemlaeLaealdeleadddvrvvvltgagkaFcaGaD
00527931   1/1  lselilveveggvatitlnrpeklNalslemlaelaealdele.dddvrvvvltgagkaFcaGaDlkela
00463001   1/1  ----lsyelilveveggvatitLnrPeklNalslemlaelaealdeleadddvrvvvltGagkaFcaGaD
00488901   1/1  llllllllllllllllmsyetvlveveggvatitlnrPeklNalslemlaelaaaldaleadddvrvvvl
00443841   1/1  ----vlveveggvavitlnrpeklnalslemleellealdeaeadddvrvvvltgagkaFcaGaDlkela
00388051   1/1  mlmeyelvlvevdggvavitlnrpeklNalslemleellealdeaeadddvrvvvltgagpkaFcaGaDl
00524871   1/1  -syetvlvevdgggslvatitlnrpeklNalslemlrellealdeleadddvrvvvltgagkaFcaGaDl
00484761   1/1  lyelilveveggvatitlnrPeklNalslemlaelaealdeleadddvrvvvltGagkaFcaGaDlkela
00526081   1/1  eyetvlvevdggvatitlnrpeklNalslemlaelaealdaleadd.vrvvvltGagkaFcaGaDlkela
00507581   1/1  ----llllleelelilveveggvatitlnrPeklNalslemlaeladaldeleadddvrvvvltGagkaF
00511371   1/1  llmsyetilvevdggvatltlnrpe.lNalslemlaelldaldaleadddvrvvvltgagdkaFcaGaDl
00369541   1/1  lsyelvlvevdggvavitLnrpeklNalslemlaelaealdale.dddvrvvvltgagpgkaFcaGaDlk
00386541   1/1  -yelvlveveggvavitLnrPeklNalnlemlaeLaealdeaeadddvrvvvltGagraFcaGaDlkela
00485181   1/1  ----llllllaaleeletilveveggvatitlnrpeklNalslemlaelaealdeleadddvrvvvltGa
00493861   1/1  msyelvlvevdggvatitlnrpe.lNalslemlaellaaldaleadddvrvvvltgagdkaFcaGaDlke
00517191   1/1  ---lvlleveggvatitlnrpeklNalslemlaeladaldaleadddvrvvvltgagdkaFcaGaDlkel
00419331   1/1  ----------------------------------------------------------------------
00419341   1/1  ---------------------erllsllprlayallp........gelrvivprhprgpldarerielll
00521421   1/1  lllldlysrllkvaviflggpivdg.....saelivaallaaeaddsvkgivlyinspGgsvtaglaiyd
00510411   1/1  ----------------------------------------------------------------------
00441601   1/1  erlldiysrllkvaviflsgpivdg.....laddvvaallaaeaddpvkgivl....yinspGGsv....
00512281   1/1  ----------------------------------------------------------------------
00526281   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GNRSQPPSVQADSIEVLNQWIESFHAFPKPIIAAVEGPAAGAGFSLVLACDFVVAASDAKFVMAYVKVGL
00504441   1/1  lkelaeladgdaeelleflrllqrllraletlpkPviAavnGaalGgGlelalacdlriaaedakfglpe
00527931   1/1  ellaagllelllallrlllelllallnlpkPviAavnGaAlGgGlelalacDlriasedakfglpevklG
00463001   1/1  lkelaellaagaalllallldlllallrlllrlllalrdlpkPviAavnGaalGgGlelalacdlriase
00488901   1/1  tGagdsekeglkaFcaGaDlkelaallglllglslaldaelllallrlllrllralrdlpkPviAavnGa
00443841   1/1  dlpggdaaelralaralarlllalltlpkPviAavnGaalGgGlelalacdlrvaaedarfglpevklGl
00388051   1/1  kelaa...gdaaelralvralqrllralltlpkPviAavnGlalGgGlelalacDlrvaaedakfglpev
00524871   1/1  kel.....gdaeellallrllqdlllalltlpkPviAavnGaalGgGlelalacdlriasedakfglpev
00484761   1/1  ellaagldlelllallrlllrlllallnlpkPviAavnGaalGgGlelalacDlriasedakfglpevkl
00526081   1/1  allaagdaeellallrlllrlllalltlpkPviAavnGaalGgGlelalacdlriaaedakfglpevklG
00507581   1/1  caGaDlkelaella.dlelllallrlllrlllalldlpkPviAavnGaAlGgGlelalacDlriasedak
00511371   1/1  kelaa...gdaeellallralqrlllalltlpkPviAavnGaalGgGlelalacdlrvaaedakfslglp
00369541   1/1  elag....daeellallrllqrlllalltlpkPviAavnGaalGgGlelalacdlrvaaedakfglpevk
00386541   1/1  dllaadaagalalllalllalarlllelllallrlpkPviAavnGaAlGgGlelalacDlriaaeedAkf
00485181   1/1  gkaFcaGaDlkelasllaee...llallrlllrlllallnlpkPviAavnGaAlGgGlelalacDlrias
00493861   1/1  laal...daeellallrllarlllalltlpkPviAavnGaalGgGlelalacdlriaaedakfllglpev
00517191   1/1  aal..gdaelllallrllqrlllalltlpkPviAavnGaalGgGlelalacdlriaaedakfglpevklG
00419331   1/1  ---------------------------gvPviavvtgpayGGgaylaalgdfviavpnArigvagpev..
00419341   1/1  DegsflEldglpgdgvvtgfaridGrpvgviandftvlgGslgpesarkaaraielAdkfglPlvtlvds
00521421   1/1  a........................lralkkpvvayvlglaasagyylalaadkgkiyalpnarvgihgp
00510411   1/1  ------------ilragakllaalaelgvPvisvvtgpayGggayamasralladfviawpnarigvmgp
00441601   1/1  ...........taglaiydalrrlk...kpvvaivlglaasagyllalaadkgkivalpnarvgihgpig
00512281   1/1  ------------------------ralkkpvvaivlglaaSagylialaadkgkiyalpnarvgihgpeg
00526281   1/1  -----------------------------PvitvvlgeayGggalamaladfvlalpnaeiav......m


                         +         -         -         -         -         *         -:210
query           TPDGGGSYEIARMLPRQLASEIMMEGKPVDPARLAHFGIVNRVAAPGQALTEALRIAENLAKESPNAVSG
00504441   1/1  vklGlvpgaggtqrlprlvglaralellltgrrlsaeeAlelGlvdevvpadellaaalalaeelaalsp
00527931   1/1  lvpgaggtvrlprlvglaralellltgrrisaeeAlelGlvnevvpdeelleaalelaeelaslsplala
00463001   1/1  dakfglpevklGlvpdvggtqrlprlvgelsralellltgrridAeeAlelGlvnevvpddelllaaale
00488901   1/1  AlGgGlelalacdlriaaeddakfglpevklGlvpgaggtqrlprlvGlarAlellltgrridAeeAlel
00443841   1/1  vpg.ggtarlprlvglaralellltgrrlsaeealelGlvdevvpadelleaalelaeelaalsplalra
00388051   1/1  klGlvpggggtqrlprlvglaralellltgrrisaeealelGlvdevvpadellaalkelalelaerlaa
00524871   1/1  klGlvpggggtvrlprlvglsralellltgrrisaeeAlelGlvdevvpddellaaalelaeelaslspl
00484761   1/1  GlvpgaggtvrlprlvglaralellltgrridAeeAlelGlvnevvpdeellaealelaeeiaalsplal
00526081   1/1  lvpgaggtqrlprlvglaralellltgrrldaeeAlelGlvdevvpaeellaaalelaeelaalsplalr
00507581   1/1  fglpevklGlvpgaggtqrlprlvGlaralellltgrridAeeAlelGLvnrvvpddelleealelaeri
00511371   1/1  evklGlvpgaggtqrlprlvglaralellltgrrlsAeeAlelGlvdevvpadellaaalalaeelaals
00369541   1/1  lGlipgaggtqrlprlvglaralellltgrrlsAeealelGlvdevvpadelleaalelaeelaalspla
00386541   1/1  glpevklGlvpgaggtqrlprlvglsrAlellltgrrldaeeAlrlGlvnrvvpddellaealalellle
00485181   1/1  edakfglpevklGlvpgaggtvrlprlvglaralellltgrridAeeAlelGlvnevvpdeelleealel
00493861   1/1  klGlvpgaggtqrlprlvglaralellltgrrldAeeAlelGlvdevvpddellaaalelaeelaalspl
00517191   1/1  lvpg.ggtqrlprlvglaralellltgrrldaeeAlelGlvdevvpddellaaalelaeelaalsplala
00419331   1/1  .........iaailgekvaaeell....gtaehalesGvvdlvvppdelrlelarllllllnksp-----
00419341   1/1  gGarpgegaeslgiagaiakllaalseagvPviavvlgpayGGgayamasralladfvialpn-------
00521421   1/1  lggalgsaedleilaelldklyerflelvaegrglslekiekladrd-----------------------
00510411   1/1  evaagilgedelealggaevhalsgvalllaedfataeellelglvdgvidppdlrevlsrllslllelp
00441601   1/1  galgsaedieilaelldklyelfvelvaegrglslekleeladrdtwl----------------------
00512281   1/1  gargdlsaedreilaalldklyerfielvaegrglslekveeladrg-----------------------
00526281   1/1  gpegaaailgedvskaeeaaealki....taydlaelglidgiidpelggahvhaevsgadtrevlaral


                         -         -         -         +         -         -         -:280
query           IKSLINHAGTATLTEHLAAERDSFVAALHHKDGGEGISAFLEKRKPNYR---------------------
00504441   1/1  lalratkrllrraldlslaealalelalfalllasedflegvraflekr---------------------
00527931   1/1  atKrllnaaldlsleealeleaallallllsedakegvaaflekrkPv----------------------
00463001   1/1  laeeiaslsplalratkrllnaaldlsleealeleaallallllsedake--------------------
00488901   1/1  Glvnrvvpadellaaalelaerlaaksplalratkrllnaaldlslee.---------------------
00443841   1/1  tkellrralelsleealelelalfalllaspdaqegvraflekrkPvf----------------------
00388051   1/1  lsplalratkrllrralelsleealelelelfalllaspdaqegvraflek-------------------
00524871   1/1  alratkrllraalelsleealeleaallallfasedakegvaaflekrkpv-------------------
00484761   1/1  ratkrllnaaldlsleealeleaallallllsedakegvaaflekrkPv---------------------
00526081   1/1  atkrllrraldlsleealelearlfalllasedak-----------------------------------
00507581   1/1  aalpplalratKrllnaaldlsl.ealeleaallallllsedakegvaa---------------------
00511371   1/1  plalaatkrllraalelsleealeleaalfallllsedakegvra-------------------------
00369541   1/1  lratkrllraalelsleeallleleaalfalllasedakegvraflekrkP-------------------
00386541   1/1  laeelaalsplalratkrllnralelsleealelearlf-------------------------------
00485181   1/1  aeeiaslsplalratKrllnaaldlsleeale--------------------------------------
00493861   1/1  alaatkrllrraldlsleeal.............edalegvraflekrkP--------------------
00517191   1/1  atkrllraaldlsleealelearlf---------------------------------------------
00419331   1/1  ----------------------------------------------------------------------
00419341   1/1  ----------------------------------------------------------------------
00521421   1/1  ----------------------------------------------------------------------
00510411   1/1  leel------------------------------------------------------------------
00441601   1/1  ----------------------------------------------------------------------
00512281   1/1  ----------------------------------------------------------------------
00526281   1/1  eall------------------------------------------------------------------