[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF07863.1


[Show Plain Result]

## Summary of Sequence Search
   1::179
  28::154  1.2e-08 30.3% 0052662 00526621 1/1   omain-like                              
  28::150  2.1e-06 24.8% 0050096 00500961 1/1   omain-like                              
  28::143  5.6e-05 29.0% 0050398 00503981 1/1   omain-like                              
  28::161  0.00013 27.3% 0041679 00416791 1/1   omain-like                              
   1::179


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHTTHTGHDANSSAGPDAGALSVTSAPRVVLDSNIWVDLLVFRDPHVEPIRAALAAGAIAPVIRADCREE
00526621   1/1  ---------------------------MkillDTnvliall.rgdplaeaarelle.gaeelvisaivla
00500961   1/1  ---------------------------llkillDTnvlialllgdpgaeaale........elvisaivl
00503981   1/1  ---------------------------MkillDTnvlialllgddplheaarellerllesglielvisa
00416791   1/1  ---------------------------ppylvvlDTnvlidalinkldlvelllelleg...kliipsiv


                         -         -         *         -         -         -         -:140
query           LRRVLAYPQFTRFAVDIDAALAEVDRFTTLEPVPTQEDADAIRLPKCKDTDDQKFIELAHFSRAALLVSK
00526621   1/1  Ellyvllrkllrgl.lspeellalleallslllglevlpldevaleaaelargygldlaDalilalAlal
00500961   1/1  aEllnvlar.klrlgrleleellellsllglrvlpldeeialeaaelalgygldpyDalilalAlalga.
00503981   1/1  ivlaEllyvl........rlgreealelleellalpllevlpldaelalraaellalrykglgldfaDal
00416791   1/1  laELeklakslrlalria.arlallllellkl...............ltsgdynDalilalAkelga.iL


                         +         -         -         -         -         *         -:210
query           DKAVLKLRSRLRRSSGVEVLPPLAFGGWLAAWVPPDDRG-------------------------------
00526621   1/1  gl.tlvTrDkdlfk--------------------------------------------------------
00500961   1/1  tLvTlDkkll------------------------------------------------------------
00503981   1/1  iaa-------------------------------------------------------------------
00416791   1/1  vTnDr...dlrekark.lgvp-------------------------------------------------