[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF07913.1


[Show Plain Result]

## Summary of Sequence Search
   1::113
   7::103  1.1e-31 50.5% 0043177 00431771 1/1   like domain                             
   8::99   2.7e-30 50.0% 0041595 00415951 1/1   like domain                             
   1::113


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFDSKAKMISMTEKAAKHVARYLERRGKGVGLRVGVKTTGCSGLAYKLEYVDEVLPEDQVFETHGIKVIV
00431771   1/1  ------llitlTeaAakrlkelleeeggglglrlgvkggGcsglsyglslvdelneddlvveldgvkvlv
00415951   1/1  -------llellllllitlTeaAakrlkellekegkeglglrlgvkggGcsglsyglslvdelneddlvv


                         -         -         *         -         -         -         -:140
query           DPKSLPYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV---------------------------
00431771   1/1  dpkslllldgltiDyvedllgsgFvfdnPnaks-------------------------------------
00415951   1/1  eldgvtvvvdpksllyllgltiDyvedll-----------------------------------------