[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF07921.1


[Show Plain Result]

## Summary of Sequence Search
   1::256
   5::241  2.9e-38 30.6% 0051568 00515681 1/1   )-binding Rossmann-fold domains         
   7::243    3e-37 30.3% 0051511 00515111 1/1   )-binding Rossmann-fold domains         
   8::244  2.6e-36 30.5% 0047681 00476811 1/1   )-binding Rossmann-fold domains         
   4::243    4e-36 30.3% 0041757 00417571 1/1   )-binding Rossmann-fold domains         
   3::248  2.6e-35 29.5% 0038042 00380421 1/1   )-binding Rossmann-fold domains         
   3::244  6.2e-35 32.3% 0051542 00515421 1/1   )-binding Rossmann-fold domains         
  11::248  6.6e-35 30.1% 0037662 00376621 1/1   )-binding Rossmann-fold domains         
   1::248  1.1e-34 29.5% 0047124 00471241 1/1   )-binding Rossmann-fold domains         
   7::243  1.1e-34 30.5% 0048286 00482861 1/1   )-binding Rossmann-fold domains         
   5::243  1.5e-34 30.1% 0052529 00525291 1/1   )-binding Rossmann-fold domains         
   8::243  1.5e-34 30.0% 0050967 00509671 1/1   )-binding Rossmann-fold domains         
  11::248  1.8e-34 31.7% 0045076 00450761 1/1   )-binding Rossmann-fold domains         
   6::240  7.5e-34 29.6% 0050365 00503651 1/1   )-binding Rossmann-fold domains         
   4::248  8.4e-34 29.7% 0035018 00350181 1/1   )-binding Rossmann-fold domains         
   9::244  8.4e-34 31.1% 0038068 00380681 1/1   )-binding Rossmann-fold domains         
   6::247    1e-33 29.0% 0036806 00368061 1/1   )-binding Rossmann-fold domains         
   5::242    2e-33 29.7% 0043703 00437031 1/1   )-binding Rossmann-fold domains         
   5::244  2.1e-33 28.6% 0038545 00385451 1/1   )-binding Rossmann-fold domains         
   8::243  2.3e-33 31.1% 0042131 00421311 1/1   )-binding Rossmann-fold domains         
  11::244  2.3e-33 32.0% 0050955 00509551 1/1   )-binding Rossmann-fold domains         
   5::244  3.8e-33 30.7% 0036194 00361941 1/1   )-binding Rossmann-fold domains         
   4::244    4e-33 27.2% 0038770 00387701 1/1   )-binding Rossmann-fold domains         
   8::245  5.3e-33 29.1% 0048614 00486141 1/1   )-binding Rossmann-fold domains         
   5::253  5.6e-33 29.4% 0043678 00436781 1/1   )-binding Rossmann-fold domains         
   5::244  5.8e-33 28.1% 0039871 00398711 1/1   )-binding Rossmann-fold domains         
   2::248  6.1e-33 30.8% 0045153 00451531 1/1   )-binding Rossmann-fold domains         
   3::244  6.8e-33 30.8% 0042429 00424291 1/1   )-binding Rossmann-fold domains         
   4::244    1e-32 30.4% 0039438 00394381 1/1   )-binding Rossmann-fold domains         
  10::240  1.1e-32 30.5% 0050383 00503831 1/1   )-binding Rossmann-fold domains         
   4::253  1.3e-32 27.2% 0051279 00512791 1/1   )-binding Rossmann-fold domains         
   5::246  1.5e-32 31.5% 0051965 00519651 1/1   )-binding Rossmann-fold domains         
   3::249  1.9e-32 30.7% 0051260 00512601 1/1   )-binding Rossmann-fold domains         
   4::244  1.9e-32 30.0% 0041366 00413661 1/1   )-binding Rossmann-fold domains         
   9::240  1.9e-32 31.8% 0036922 00369221 1/1   )-binding Rossmann-fold domains         
   1::246    2e-32 29.0% 0035471 00354711 1/1   )-binding Rossmann-fold domains         
  10::241  2.4e-32 30.6% 0050655 00506551 1/1   )-binding Rossmann-fold domains         
   5::244    3e-32 30.4% 0038814 00388141 1/1   )-binding Rossmann-fold domains         
   1::246  3.1e-32 32.2% 0051006 00510061 1/1   )-binding Rossmann-fold domains         
   3::248  3.4e-32 30.8% 0038342 00383421 1/1   )-binding Rossmann-fold domains         
   8::240  4.3e-32 30.4% 0050776 00507761 1/1   )-binding Rossmann-fold domains         
   8::248  5.1e-32 30.0% 0051355 00513551 1/1   )-binding Rossmann-fold domains         
   5::248  1.2e-31 29.8% 0051702 00517021 1/1   )-binding Rossmann-fold domains         
   1::240  1.4e-31 31.2% 0051763 00517631 1/1   )-binding Rossmann-fold domains         
   4::244  1.9e-31 28.7% 0041610 00416101 1/1   )-binding Rossmann-fold domains         
   2::240  2.4e-31 28.5% 0053286 00532861 1/1   )-binding Rossmann-fold domains         
   9::253  3.1e-31 30.4% 0049845 00498451 1/1   )-binding Rossmann-fold domains         
   5::242  3.2e-31 30.3% 0050237 00502371 1/1   )-binding Rossmann-fold domains         
   8::240  3.2e-31 31.7% 0052085 00520851 1/1   )-binding Rossmann-fold domains         
  11::244  6.2e-31 31.6% 0051093 00510931 1/1   )-binding Rossmann-fold domains         
  10::240  6.9e-31 29.0% 0051440 00514401 1/1   )-binding Rossmann-fold domains         
   4::243  8.2e-31 28.6% 0040910 00409101 1/1   )-binding Rossmann-fold domains         
   6::243  1.3e-30 30.4% 0041692 00416921 1/1   )-binding Rossmann-fold domains         
   8::240  1.4e-30 31.4% 0046483 00464831 1/1   )-binding Rossmann-fold domains         
   5::254  1.6e-30 29.2% 0035305 00353051 1/1   )-binding Rossmann-fold domains         
   9::240  1.9e-30 31.1% 0048243 00482431 1/1   )-binding Rossmann-fold domains         
   5::248  2.2e-30 29.4% 0049942 00499421 1/1   )-binding Rossmann-fold domains         
   8::244  2.5e-30 29.2% 0038559 00385591 1/1   )-binding Rossmann-fold domains         
   8::240  9.1e-30 30.2% 0047470 00474701 1/1   )-binding Rossmann-fold domains         
   3::240  1.1e-29 27.4% 0049943 00499431 1/1   )-binding Rossmann-fold domains         
   4::240  1.9e-29 27.1% 0052988 00529881 1/1   )-binding Rossmann-fold domains         
  10::238  2.1e-29 34.6% 0051109 00511091 1/1   )-binding Rossmann-fold domains         
   9::240  2.3e-29 31.3% 0051955 00519551 1/1   )-binding Rossmann-fold domains         
  10::243  3.1e-29 27.0% 0042505 00425051 1/1   )-binding Rossmann-fold domains         
   8::240  3.8e-29 29.0% 0053266 00532661 1/1   )-binding Rossmann-fold domains         
   8::240  4.9e-29 28.2% 0052368 00523681 1/1   )-binding Rossmann-fold domains         
   3::244  7.2e-29 29.0% 0050022 00500221 1/1   )-binding Rossmann-fold domains         
   8::253  1.9e-28 28.8% 0052873 00528731 1/1   )-binding Rossmann-fold domains         
   7::245  5.3e-28 32.4% 0052744 00527441 1/1   )-binding Rossmann-fold domains         
   9::243  6.9e-28 29.1% 0046801 00468011 1/1   )-binding Rossmann-fold domains         
   3::237  1.6e-27 27.2% 0046592 00465921 1/1   )-binding Rossmann-fold domains         
  10::240  1.7e-27 28.6% 0048949 00489491 1/1   )-binding Rossmann-fold domains         
   8::202  3.5e-27 30.0% 0049428 00494281 1/1   )-binding Rossmann-fold domains         
   8::241  1.2e-26 29.0% 0051203 00512031 1/1   )-binding Rossmann-fold domains         
   8::241  7.1e-26 28.4% 0049902 00499021 1/1   )-binding Rossmann-fold domains         
   9::241  6.8e-25 27.5% 0048361 00483611 1/1   )-binding Rossmann-fold domains         
  10::248  1.3e-24 31.3% 0049026 00490261 1/1   )-binding Rossmann-fold domains         
  11::252    3e-23 27.7% 0049519 00495191 1/1   )-binding Rossmann-fold domains         
  11::198    8e-23 33.5% 0048035 00480351 1/1   )-binding Rossmann-fold domains         
  10::242  1.3e-22 27.6% 0050721 00507211 1/1   )-binding Rossmann-fold domains         
   1::248  8.2e-22 30.0% 0046574 00465741 1/1   )-binding Rossmann-fold domains         
  10::246  1.4e-21 27.7% 0046034 00460341 1/1   )-binding Rossmann-fold domains         
  10::252  2.2e-21 29.0% 0048293 00482931 1/1   )-binding Rossmann-fold domains         
  10::246  4.2e-21 27.3% 0046897 00468971 1/1   )-binding Rossmann-fold domains         
  10::245  3.9e-20 26.9% 0049357 00493571 1/1   )-binding Rossmann-fold domains         
  10::245  4.2e-20 28.4% 0051183 00511831 1/1   )-binding Rossmann-fold domains         
   8::246  6.5e-20 31.2% 0051491 00514911 1/1   )-binding Rossmann-fold domains         
  10::242  2.8e-19 27.8% 0049864 00498641 1/1   )-binding Rossmann-fold domains         
   8::244  4.9e-19 26.7% 0053287 00532871 1/1   )-binding Rossmann-fold domains         
  10::252  8.5e-18 29.6% 0043337 00433371 1/1   )-binding Rossmann-fold domains         
  10::246  2.2e-17 26.8% 0049117 00491171 1/1   )-binding Rossmann-fold domains         
   8::246  4.9e-17 27.0% 0046472 00464721 1/1   )-binding Rossmann-fold domains         
  11::252  1.6e-16 27.4% 0037128 00371281 1/1   )-binding Rossmann-fold domains         
  10::250  2.4e-15 28.9% 0052722 00527221 1/1   )-binding Rossmann-fold domains         
   1::248  6.3e-15 26.9% 0040043 00400431 1/1   )-binding Rossmann-fold domains         
   1::243  1.7e-14 25.9% 0038324 00383241 1/1   )-binding Rossmann-fold domains         
  10::243  2.8e-13 25.8% 0041999 00419991 1/1   )-binding Rossmann-fold domains         
  11::248  2.8e-13 28.8% 0046291 00462911 1/1   )-binding Rossmann-fold domains         
  10::244  3.4e-13 27.3% 0043041 00430411 1/1   )-binding Rossmann-fold domains         
   8::245  5.3e-13 24.5% 0051696 00516961 1/1   )-binding Rossmann-fold domains         
  13::253  5.6e-13 26.9% 0051991 00519911 1/1   )-binding Rossmann-fold domains         
  13::164  3.7e-12 26.7% 0046529 00465291 1/1   )-binding Rossmann-fold domains         
  10::195  1.9e-11 25.0% 0048186 00481861 1/1   )-binding Rossmann-fold domains         
  10::169  2.3e-11 26.2% 0038784 00387841 1/1   )-binding Rossmann-fold domains         
  10::198  2.7e-10 29.9% 0051925 00519251 1/1   )-binding Rossmann-fold domains         
   1::243  5.1e-10 25.5% 0043042 00430421 1/1   )-binding Rossmann-fold domains         
   3::164  6.1e-10 22.9% 0047965 00479651 1/1   )-binding Rossmann-fold domains         
  13::170  1.4e-09 31.4% 0049686 00496861 1/1   )-binding Rossmann-fold domains         
   2::181  3.3e-08 23.3% 0048516 00485161 1/1   )-binding Rossmann-fold domains         
  10::245  8.2e-08 28.9% 0047178 00471781 1/1   )-binding Rossmann-fold domains         
   8::202  2.6e-07 26.0% 0036785 00367851 1/1   )-binding Rossmann-fold domains         
  13::169  6.1e-07 23.1% 0035477 00354771 1/1   )-binding Rossmann-fold domains         
   7::179  6.4e-07 25.0% 0042180 00421801 1/1   )-binding Rossmann-fold domains         
  10::198  6.5e-06 25.2% 0052116 00521161 1/1   )-binding Rossmann-fold domains         
   4::44     8e-06 34.1% 0042906 00429061 1/1   )-binding Rossmann-fold domains         
  13::121  0.00024 23.8% 0035290 00352901 1/1   )-binding Rossmann-fold domains         
   1::256


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTTGTPRSTHLYIVTGASRGLGAALVRALLVPGNRVIGVARSRNPELEAEATASGVRVAWHLQDLSQPGP
00515681   1/1  ----mdlkgkvalvTGassgiGlaiAralaaaGarVvltdrneekleelaaelealggrvlavalDvtde
00515111   1/1  ------LkgkvalvTGAssGiGraiAralaalleegarVvlvarneekleelaaeleallpggrvlaval
00476811   1/1  -------kgkvalvTGassGiGlaiAralaaaGarlllVvltdrneekleelaaelrallpsggrvlava
00417571   1/1  ---mmdlkgkvalvTGAssGiGraiAralaalleeGarvvltarneekleelaaeleallpggrvlaval
00380421   1/1  --mmlslkgkvalvTGassGiGlaiaralaaaGarVvlldrneekleelaaeleallggrvlavalDvtd
00515421   1/1  --mmldlkgkvalvTGassGiGraiAralaarGarVvladrseelaeleagleklealaeelggrvlava
00376621   1/1  ----------llllmllslkgkvalvTGassgiGraiAralaaaGarVvltdrneekleelaaelealgg
00471241   1/1  llmllslkgkvalvTGassGiGlaiAralaaaGarVvltdrseekleelaaeleallggrvlavalDvtd
00482861   1/1  ------mlkgkvvlvTGassGiGlalaralaarGasrVvlldrneekleelaaelealggrvlfvqlDvt
00525291   1/1  ----gdlsgkvalvtGassgiGlaiAralaaeGarVvltdrneleelaaelealggrvlavalDvtdees
00509671   1/1  -------dlkgkvalvTGassgiGlaiAralaaeGarVvltdrneekleelaaelealglpsgrvlaval
00450761   1/1  ----------llvlllllllllslkgkvalvTGassgiGraiaralaaaGarVvlldrsseekleelaae
00503651   1/1  -----slkgkvalvtGassgiGlaiAralaeeGakVvltdrneekleelaaelealggkvlavalDvtde
00350181   1/1  ---mmdlkgkvalvTGassgiGlaiaralaaaGarVvlldrneekleelaaelralggrvlavalDvtde
00380681   1/1  --------gkvalvTGasggiGlaiaralaaeGarVvlldrneekleelaaelealggrvlavalDvtde
00368061   1/1  -----dlkgkvalvTGassgiGlaiAralaaaGarVvlldrneekleelaael.ggrvlavalDvtdees
00437031   1/1  ----mdlkgkvalvtGassGiGraiAralaaeGarVvltdrneekleelaaelrallplggrvlavalDv
00385451   1/1  ----ldlkgkvalvTGasggiGlaiAralaaaGarVvlldrseekleelaael.ggrvlavalDvtdees
00421311   1/1  -------kgkvalvTGassgiGraiAralaaeGarVvltdrnseekleelaaeleallggralavalDvt
00509551   1/1  ----------lllmlldlkgkvalvTGassgiGlaiAralaaaGarVvlldrneekleelaaeleallpg
00361941   1/1  ----mdlkgkvalvtGasggiGraiaralaaaGarVvlldrneekleelaaelg..rvlavvlDvtdees
00387701   1/1  ---mmdlkgkvalvTGasggiGlaiaralaaeGarVvlldrneekleelaael.ggrvlavalDvtdees
00486141   1/1  -------kgkvvlvtGgsggiGsalaralaaeGakvvlvdrseealae......gggalavaaDvtdeea
00436781   1/1  ----mdlkgkvalvTGassgiGlaiAralaaaGarVvlldrseekleelaael.ggrvlavalDvtdees
00398711   1/1  ----mdlkgkvalvTGassgiGraiaralaaaGarVvlldrneekleelaael.ggrvlavalDvtdees
00451531   1/1  -psllslkgkvalvTGassgiGlaiAralaaaGarVvltdrneekleelaaelealggrvlavalDvtde
00424291   1/1  --mmlslkgkvvlvtGasggiGralaralaaaGarVvlldr..seekleelaaelgrvlavvlDvtdees
00394381   1/1  ---mmslkgkvalvTGassgiGraiaralaaaGarVvltdrsgeekleelaaelealggrvlavalDvtd
00503831   1/1  ---------lllllllllllllldlllslldlkgkvalvTGasgGiGraiAralaaaGarVvlldrneek
00512791   1/1  ---lldlkgkvalvTGassgiGlaiAralaaaGarVvlldrneekleelaaelg..rvlavalDvtdees
00519651   1/1  ----smdlkgkvalvTGassgiGlaiAralaaaGarVvltdrneekleelaaelea.ggrvlavqlDvtd
00512601   1/1  --sdmslkgkvalvTGasggiGlalAralaarGarVvlldrseekleelaaelealggrvlvvalDvtde
00413661   1/1  ---mmdlkgkvalvtGassgiGlaiaralaaeGarVvlldrne.ekleelaaelggrvlavalDvtdees
00369221   1/1  --------gkvalvTGassgiGlaiAralaaaGarVvlldrsgaekleelaaelealggrvlavalDvtd
00354711   1/1  Ms....lkgkvvlvTGasggiGralaralaaaGarVvlldrseekleelaael.ggrvlavalDvtdees
00506551   1/1  ---------sGmkvalvTGassgiGlaiaralaealGakVvltdrneekleelaaelealggrvlfvalD
00388141   1/1  ----ldlkgkvalvTGassgiGraiaralaarGarVvlldrse.ekleelaaelggrvlavalDvtdees
00510061   1/1  m....slkgkvalvTGassgiGlaiAralaaeGarVvltdrneekleelaaelealglpsgrvlavalDv
00383421   1/1  --pslslkgkvalvTGasgGiGralaralaarGarVvlldrsglssllllsaekleelaaelggrvlava
00507761   1/1  -------mlkgkvalvTGassgiGlaiAralaaeGarVvltdlrneekleelaaellealggrvlavalD
00513551   1/1  -------lkgkvalvTGasggiGlaiaralaeeGdlakVvlldrneekleelaael.ggrvlfvqlDvtd
00517021   1/1  ----ldlkgkvalvtGassgiGlaiAralaaaGarVvlldrseekleelaael.ggrvlavalDvtdees
00517631   1/1  m...ldlkgkvalvtGassgiGlaiaralaaaGarVvlldrneekleelaae...grvlavalDvtde..
00416101   1/1  ---mmslkgkvalvTGassgiGlaiAralaaeGarVvltdrne.ekleelaaeleaggrvlavalDvtde
00532861   1/1  -sdmldlkgkvalvtGassgiGlaiAralaeeGakVvltdrneekleelaaelealggkvlavalDvtde
00498451   1/1  --------gkvalvTGassgiGralaralaarGarVvlldrsee..........ggrvlavaaDvtdees
00502371   1/1  ----mdlkgkvalvtGassgiGlaiAralaaaGarVvltdrnaekleelaaellealggrvlavalDvtd
00520851   1/1  -------llsllsllkgkvalvtGassgiGlaiAralaaaGarVvltdrsaekleelaaelealggrvla
00510931   1/1  ----------llllmlldlkgkvalvTGassGiGraiAralaaaGarVvltarneekleelaaelralgg
00514401   1/1  ---------gsslldmldlkgkvalvTGasggiGraiAralaaaGarVvlldrneekleelaaeleaelp
00409101   1/1  ---mmdlkgkvalvTGassgIGlaiaralaaeGarvvlldrneekleelaaelealpggrvlavalDvtd
00416921   1/1  -----dlkgkvalvtGassgiGraiaralaaeGarVvltarneekle.......ggralavvlDvtde..
00464831   1/1  -------sgkvalvTGassGiGlaiAralaaeGakVvlltdrneekleelaeeleallggkvlavalDvt
00353051   1/1  ----mdlkgkvalvTGassGIGlaiAralaarGarvvlldrneekleelaaelralpggrvlavalDvtd
00482431   1/1  --------lpvalvTGassGiGlaiAralaaaGarVvltdrlneekleelaaelralpggrvlavalDvt
00499421   1/1  ----ldlkgkvalvtGassgiGlaiaralaaaGarVvlldrseekleelaael...rvlavalDvtdees
00385591   1/1  -------egkvvLVtGgsggiGraiaralaaaGarVvvvdrseeal........gggvlavaaDvtdeea
00474701   1/1  -------dlkgkvalvtGassgiGlaiAralaaeGarVvltdrneekleelaaelealggkarvlavalD
00499431   1/1  --lmlldlkgkvalvtGAagssgiGlaiAralaeeGakVvltdrneekleelaeeleelg.kvlavalDv
00529881   1/1  ---llslkgkvalvtGasselgiGlaiAralaaeGarVvltdrneealeelaaeleggralavalDvtde
00511091   1/1  ---------sslsllldmlslkgkvalvTGasggiGralaralaarGarVvlldrseekleelaaeleal
00519551   1/1  --------kkvalvtGassgiGlaiAralaeeGarlllleeeVvltdrneekleelaaelealggkvlav
00425051   1/1  ---------kvalvTGassgiGraiAlalaaeGarVvltdrneealeela....ggkalavalDvtdees
00532661   1/1  -------gslkgkvalvtGAaGssgiGlaiAralaeeGakVvltdrneekleela.ellalggkvlaval
00523681   1/1  -------dllkgkvalvtGassgiGlaiaralaeeGakVvltdr..nee..leelaeelkvlavalDvtd
00500221   1/1  --lllslkgkvalvTGassgiGlaiAralaaeGarVvlldrseeale.........rvlavalDvtdees
00528731   1/1  -------lkgkvalvTGassgiGlaiaralaaeGarVvlldrneekleelaaeleallpggrvlavalDv
00527441   1/1  ------amdlgllsgkvvlvTGasggiGralaralaarGarvVvlldrsglleekleelaaelealggrv
00468011   1/1  --------gkvalvTGassgiGraiaralaaaGarVvlldrneek...............vqlDvtdees
00465921   1/1  --mlldlkgkvalvtGaanssgiGraiAralaaeGarVvltdr.neealeelaaeleaalpsslllelee
00489491   1/1  ---------gllkgkvalvtGAagssgiGlaiAralaeeGakVvltdrn..ekleelaeeleaagg.kvl
00494281   1/1  -------emktvlitGAnRGiGlelvkqllelakrgllviataRdpekaeeleelaaegsnlvilqldvt
00512031   1/1  -------dslsllslkgkvalvTGassGiGraiAralaeeGarVvltdrneekleelaaelealgggkvl
00499021   1/1  -------kgkvalvtGasnesgIGraiAlalaeeGakVvltdr.neealeelaaelealldeslllslel
00483611   1/1  --------GkvalvtGasnesgiGraiAlalaeeGakVvitdr.neealeelaaeleallseelllelee
00490261   1/1  ---------ktvlvTGatGgiGsalaraLlarGaeVvaldrspeklealaaeleallpllllfellglld
00495191   1/1  ----------rktvlvTGatGgiGsalaraLlarGaeVvlldrlssglspekleellaellealgggvef
00480351   1/1  ----------gllldtallvllllllllldlkgkvalVtGasggiGlaiAralaaaGarVvladrne.ek
00507211   1/1  ---------ldmmslmgktvlvTGatGgiGsalaraLlarGaeVvlldrspekleelaaelealg.gvef
00465741   1/1  M.......gktvlvTGatGgiGsalaraLlarGaeVvlldrspsslllllekleelaaelealgggvefv
00460341   1/1  ---------gktvlvTGatGgiGsalaraLlarpGaeVvaldrltsagspeklealaael...gvefvqg
00482931   1/1  ---------nktvlvTGatGgiGsalaraLlarGaeVvlldrlssgaseekleelaaelraaggpgvefv
00468971   1/1  ---------ktvlvTGatGgiGsalaraLlarpGaeVvaldrlsspeklealaallgalgvefvqgDltd
00493571   1/1  ---------llsllsslldllslkgktvlvTGatGgiGsalaraLlarGaeVvlldrspekleelaaele
00511831   1/1  ---------llllmmmslegktvLVTGAtGfiGsalvrrLlerGyeVvaldrspekleelaallealggd
00514911   1/1  -------S.KtvlvTGatGgiGsalaraLlerGaeVvlldrspekleellaeleallgggvefvqgDltd
00498641   1/1  ---------krvLvTGgtGfiGsalaraLlerGaevvvldrseekleelleeleallggrvefvegDltd
00532871   1/1  -------lsgktvlVtGAtGgiGsalvrrLleagdvaevvalvrspek...leelgg..gvevvvgDltd
00433371   1/1  ---------ktvLVTGatGfiGsalaraLlerGyrVvaldrdpekleellaelealgggvefvegDltdp
00491171   1/1  ---------ktvlvTGatGgiGsalaraLlallllslaGaevvaldrspseealealaellalggvefvq
00464721   1/1  -------MgktvlvtGatGfiGsalaraLlarGaveVvaldrspe...................Dltdp.
00371281   1/1  ----------kvlVTGgaGfiGsalvraLlerGyeevvvldrlesgakl......gpgvefvegDltdp.
00527221   1/1  ---------llllkillslkgkkvlvtGAtGgiGralvkellargavskvialvRrpekleelaae....
00400431   1/1  M.......gkkvLvTGgtGfiGsalvraLlerGaevvvldrdpegaaellallealggprvefvagDltd
00383241   1/1  M.......gkrvLvTGgtGfiGshlvraLlerpGhevvvldrlpsgadallellalltlllsllekllll
00419991   1/1  ---------kkvLvTGgtGfiGshlaraLlerGaevvvldrlsegaeellaelealgprvefvkgDltdp
00462911   1/1  ----------skkvLvTGatGfiGsalvrrLlerGyeVialdrlssgsneekleellkelellgpgvefv
00430411   1/1  ---------MsgkkvlvtGAtGfiGshlaraLleaGhevvalvRspekaalalalelleelaa..pgvev
00516961   1/1  -------kgkrvlvtGAtGfiGshlvrrLlaeghvsevvalvrrpsk........llpgvevvvgDltdp
00519911   1/1  ------------lllllllimmmlkgkkvlvtGAtGgiGralvkeLlergavskVtalvRrpekleelaa
00465291   1/1  ------------PctplgvllllellgillllllmmlrlkgkvalVtGassgiGralAllLareGatVvv
00481861   1/1  ---------kkvlvtGAsGgiGsalalllaargaevvlldrspeklegvaldlsdlgvevvvadltdp..
00387841   1/1  ---------kkvlvtGAsGgiGsalalllakegaevvlvdrdeekalealagelldlgggalvlvadvtd
00519251   1/1  ---------kkkilvtGatGfiGsalaraLlergyevialdrspekleellkll....vefvkgDltdp.
00430421   1/1  M......kgmkvlvtGgtGfiGshlvraLleaGhevvvlvRnpskgkaaklelleellglgvevvegDlt
00479651   1/1  --GkplvlggslgrseatgygvvysllaalkrllmglslegkvvlVtGaG.giGraiarrlaaeGakVvv
00496861   1/1  ------------lvtGAtGgiGlavvrlllkrGykViaid..rseekleklkelgadvvldvtd......
00485161   1/1  -lsleeaAalplagltaylallllldlagllpgktvlvtGAaggiGsaaaqllaalGarViavdrs..ee
00471781   1/1  ---------mmmmkvlvtGAtGfiGsalvrelleagheVtalvRdpsklaall....glgvevvvgDltd
00367851   1/1  -------kgkkvlviGa.GgiGralaraLaeaGaevtvadrslekaealaael................g
00354771   1/1  ------------MlkgmkvlVtGAaGgiGsalalrlaarglagldllvevvlldrsealealegvaldls
00421801   1/1  ------DgigavsllkrllvdlpgkkvlvlGaG.giGralalalaaagaevvvvnrtlekaeelaeelga
00521161   1/1  ---------MslllllllllmlkgmkilVTGaaGfiGshlvrrLlerGyevvaldrspekleelld....
00429061   1/1  ---aklkpgktvlvtGAaggvGlaaaqlakalGarViatarsee--------------------------
00352901   1/1  ------------lVtGasggiGraiallLaraGatVtvtdrntenleeavkeaDivivavgvpglvkael


                         -         -         *         -         -         -         -:140
query           SAGWLASVLDAVEEAPASITLILNAGVVEPIGPITQLHDSTLVPHLQTNLVTPMTMTGAFIEHTVRFDCP
00515681   1/1  esvealveavleefgrldi...lvnnaGillplgplldlsledfervldvnllgtflltraalplmrkrg
00515111   1/1  DvtdeesvealveavlellleefgrldilvnnAGillplllgplleltledwdrvldvnllgvflltraa
00476811   1/1  lDvtdeesvealveav.....efgrldiLvnnAGialp.gpleelsledwervldvNllgtflltraalp
00417571   1/1  DvtdeesvealveavlellleefgrldilvnnAGillplllgpllelsledwdrvldvnllgvflltraa
00380421   1/1  eesvealveaaleefg...rldilvnnagillp.gplldlsledfervldvnllgtflltraalplmrkr
00515421   1/1  lDvtdeesvaalvaavleefg..rldi.lvnnAGilld.gpleeltledwervldvnllgaflltraalp
00376621   1/1  rvlavalDvtdeesvealveaileefg...rldilvnnagillp..pllelsledfervldvnllgvfll
00471241   1/1  eesvealveavleefgrldi...lvnnAgillp.gplleltledfervldvnllgvflltraalplmrkr
00482861   1/1  deesvealveevleefgrldi...lvnnAGil...gpledlsledfllervldvNvlgtflltraalpll
00525291   1/1  vealveavleefgrldi...lvnnagillp.gplldlsledfervldvnllgvflltraalpllrkrg.g
00509671   1/1  Dvtdeesvealveevleefgrldi...lvnnAgialpgpgllldlsledfervldvnllgtflltraalp
00450761   1/1  lealggrvlavalDvtdeesvealveavleefgrldi...lvnnAgillp.gpleelsledfervldvnl
00503651   1/1  esvealveeileefgrldi...lvnnagillp.gplldlsledwervldvnllgvflltkaalplllmrk
00350181   1/1  esvealveavleefggrldi...lvnnagillp.gplldltledfervldvnllgtflltraalpllrkr
00380681   1/1  esvaalveavleefg...rldilvnnagillv.gplldlsledfervldvnllgtflltraalplmrkrg
00368061   1/1  vealveaaleefgrld...ilvnnAgillpllllllgplldlsledfervldvnllgtflltraalplmr
00437031   1/1  tdeesvealveavleefgrld...ilvnnagillpllllgplldlsledfervldvnllgvflltraalp
00385451   1/1  vealvaealeefgrldi...lvnnAgillv.gplldlsledfervldvnllgtflltraalpllrkrg.g
00421311   1/1  dealaeeleelelllllllesvealveaalerfgrldilvnnAgialvgallglllllllllkplldlsl
00509551   1/1  grvlavalDvtdeesvaalvaavleefgrldi...lvnnAgillp.gpllelsledwervldvnllgtfl
00361941   1/1  .......veaaveelggldvlvnnagialp.gplldlsledfervldvnllgtflltraalplmrkrglg
00387701   1/1  vealveavleefg...rldilvnnAgialp.gplldlsledfervldvnllgtflltraalplmrkrg..
00486141   1/1  vealveaaveafggldv...lvnnagillplgplldlsledwdrvldvnllgtflllraalpllvk...g
00436781   1/1  vealvaaaleefgrldi...lvnnAgillpllllllgplldlsledfervldvnllgtflltraalplmr
00398711   1/1  vealvaavleefg...rldilvnnAgillv.gplldlsledfervldvnllgtflltraalplmrkrglg
00451531   1/1  .......esvealveaileefggrldilvnnagillp.gplldltledfervldvnllgvflltraalpl
00424291   1/1  .......veaaveelggldvlvnnagiall.gplldlsledfervldvnllgtflltraalplmrkaglg
00394381   1/1  eesvealveavleefg...rldilvnnagillp.gplldlsledfervldvnllgtflltraalplmlkr
00503831   1/1  leelaaeleallggrvlavalDvtdeesvealveeileefgrldi...lvnnAgil.avgpledlsledf
00512791   1/1  vealveavleefgrldi...lvnnagillvlgplldlsledwervldvnllgtflltraalplmrkrg..
00519651   1/1  eesvealveevleefgrldi...lvnnAgilgpllgplldlsledfervldvnllgtflltraalplmrk
00512601   1/1  esvealveevleefgrldi...lvnnAgillv.gplldlsledfervldvnllgtflltraalplmrkrg
00413661   1/1  vealveavleefgrldi...lvnnagillp.gplldlsledfervldvnllgtflltraalpllrkrg.g
00369221   1/1  eesvealvaavleefgrldi...lvnnagilld.gplldltledfervldvnllgtflltraalplmrkr
00354711   1/1  veaaveavleefggldv...lvnnAgillvlllllgpledlsledwervldvNvlgtflltraalplmrk
00506551   1/1  vtdeesvealveeileefgrldi...lvnnAGil..vgpledlsleldfervldvNllgtflltkallpl
00388141   1/1  vaalvaavleefgrldi...lvnnagvlld.gplldltledfervldvnllgtflltraalpllrkrg.g
00510061   1/1  tdeesvealveavleefgrldi...lvnnaGialp.gplegslldlsledfervldvnllgtflltraal
00383421   1/1  lDvtdeesvealveaaleefg..rldi.lvnnAgilld.gplleltledwervldvnllgtflltraalp
00507761   1/1  vtdeesvealveevleefgrldi...lvnnagialp.gplldlsledfervldvnllgtflltraalplm
00513551   1/1  eesvealveeileefgrlgldi.lvnnAgillplgplldlsledfervldvNllgtflltkaalplmkkr
00517021   1/1  vealvaavleefgrldi...lvnnagilll.gplldlsledwdrvldvnllgtflltraalplmlkr...
00517631   1/1  .....esvealveefgrldilvnnagillv.gplldlsledfervldvnllgtflltraalpllrkrg.g
00416101   1/1  esvealveavleefgrldi...lvnnagillp.gplldltledfervldvnllgtflltraalplmrkrg
00532861   1/1  esvealveeileefggrldi...lvnnagil.llgplldlsledwervldvnllgvflltkaalplmrkr
00498451   1/1  vealvaaale.fgrld...ilvnnAgillpllllgplldlsledwdrvldvnllgtflltraalplmrkr
00502371   1/1  eesvealveavleefgrldi...lvnnagillp.gplldlsledfervldvnllgvflltraalpllrkr
00520851   1/1  valDvtdeesvealveavleefgrldi...lvnnagillp.gplldlsledfervldvnllgtflltraa
00510931   1/1  drvlavalDvtdeesvealveavleefg..rldi.lvnnAgillp.gpledltledwervldvNllgvfl
00514401   1/1  lllggrvlavalDvtdeesvealveeileefgrldi...lvnnAgilav.gpledlsledfervldvNvl
00409101   1/1  elesvealveealeefgridi...lvnnAGi.........lsledwervldvNllgtflltraalplmrk
00416921   1/1  .......veaaleafgrldilvnnagiall.gplldlsledwdrvldvnllgvflltraalplmlkrg.g
00464831   1/1  dllelleleleelleleleesvealveeileefgrldilvnnAGialp.gpllllkslllsellgslldl
00353051   1/1  elesvealveevleefgrld...ilvnnAGi.........lsledwervldvNllgvflltraalplmrk
00482431   1/1  deesvlellealveavleefgrldilvnnaGial.pgpllgllllllllldlsleadwervldvnllgvf
00499421   1/1  vealvaavleefgrldi...lvnnagilld.gplldltledfdrvldvnllgtflltraalplmrkrg.g
00385591   1/1  vaalvaaavellefggldv.lvnnagilavgeplldlsledwdrvldvnllgtflllraalplmvk...g
00474701   1/1  vtdeesvealveavleefgrldi...lvnnagillplgplldlsledfervldvnllgvflltraalpll
00499431   1/1  tdeesvealveeileefgrldi...lvnnaGiaglslllgplldlsledwervldvnllgvflltkaalp
00529881   1/1  esvealvaaavellgefgrldilvnnagialllllllgplldlsledwdrvldvnllgvflltraalplm
00511091   1/1  gggrvlvvaaDvtdeesvealveeileefgrldi...lvnnAgillpdgpled.sledfervldvNvlgt
00519551   1/1  alDvtdeesvealveeileefgrldi...lvnnagillp.gplldlsledwervldvnllgvflltkaal
00425051   1/1  vealveaaveefgrldi...Lvnnagialllgplldlsledwdrvldvnllgvflltraalplmlkrg.g
00532661   1/1  Dvtdeesvealveeileefgrldi...lvnnaGiagklellgplldlsledwervldvnllgtflltkaa
00523681   1/1  eesvealveeileefgrldi...lvnnagilll.gplldlsledwervldvnllgvflltkaalplmrkr
00500221   1/1  vaalvaavleefgrldi...lvnnagilll.gplldltledfdrvldvnllgvflltraalplmrkrg.g
00528731   1/1  tdeesvealveevleefgrldi...lvnnaGil.........sledfervldvnllgtflltraalpllr
00527441   1/1  lfvaaDvtdpesvealvaeileef.gldv...lvnnAgillv.gpledlsledfervldvnvlgtfnllr
00468011   1/1  vealveavleefggrldi...lvnnAGialpgpll........ervldvNllgtflltraalpllrkrg.
00465921   1/1  lleleelleleaaleeleeleggralavaaDvtdeesvealvaaaveefgrldi...Lvnnagiallllg
00489491   1/1  avalDvtdeesvealveeileefgrldi...lvnnaGildldllllgplldlsledwervldvnllgvfl
00494281   1/1  deesieelaaeveellgdggldv.linnAGillpsgslgeldleellevfevnvlgpllltqallpllkk
00512031   1/1  avalDvtdeesvealveeileefg....rldilvlnnAGillp.gpled.sledwervldvNllgtfllt
00499021   1/1  llelekllellaallelsdleggkalavaaDvtdeesvealvdaivekfgrldi...Lvnnagiagellg
00483611   1/1  lleleelleleaaleeledleggkalavaaDvtdeesvealvdaaverfgrldi...Lvnnagialllgg
00490261   1/1  ellggrvefvegDltdp.......esleaaleev.gvDvvvhnAgissv.gpse.ltledpeevldvNvl
00495191   1/1  vqgDltdp.......eslaaalagv.rldvvvhnAgivgv.....dlseedpeevldvNvlgtlnlleaa
00480351   1/1  lealaaelgalgralavaadvtdpesvealv..........ggldilvnnagilgallgplldltledwe
00507211   1/1  vqgDltdp.......eslaaalagvriDv.vvhnAgi.....plvdlseedpeevldvNvlgtlnlleaa
00465741   1/1  qgDltdp.......eslaaaleevgvdv.vihnAgi.....plvdlseedpeevldvNvlgtlnlleaal
00460341   1/1  Dltdp.......eslaaalagv.riDvvihnAgivsv.....dlseedpeevldvNvlgtlnlleaalpa
00482931   1/1  qgDltdp.......eslaaalagv.rldvvvhnAgissv.....dlseedpeevldvNvlgtlnlleaal
00468971   1/1  p.......eslaaalagvridv.vihnAgiv.....lvdlseedpeevldvNvlgtlnlleaalpagvkr
00493571   1/1  alggslllggvefvqgDltdp.......esleaala...gvdvvvhnAgivgv.....dlseedpeevld
00511831   1/1  pgvelvvgDltdp.......esleaale...gvdvvihlAgiasvg........edpeelidvNvlgtln
00514911   1/1  p.......eslaaaleev.gvdvvvhnAgivgv.....dlseedpeevldvNvlgtlnlleaalpa....
00498641   1/1  p.......ealeaaleev.gvdvvihlAgissv.....dlseedpeevldvNvlgtlnlleaarka....
00532871   1/1  p...........dslaaalagvdavvhlagivgvgalllllllksllelseedpeevldvnvlgtlnlle
00433371   1/1  eslaaalagv........rpdvvvhlAalssv.....dlseedpeevldvNvlgtlnlleaarea....g
00491171   1/1  gDltdp.......eslaaala...gvdvvvhnAgivsv.....dlseedpeevldvNvlgtlnlleaark
00464721   1/1  ......eslaaalagvrvdv.vihlAgi....vsavdlseedpeevldvNvlgtlnlleaarka.....g
00371281   1/1  ...esleaaleevekfggvdvvihlAaissvd.......esdpeelldvNvlgtlnlleaarka......
00527221   1/1  gvevvvgDltdp.......eslaealkgvd...vvinaagttrfg........edleeflavnvdgtlnl
00400431   1/1  p.......ealeaala...gvdaVvhlAalshv.....dlseedpeevlevNvlgtlnlleaarka....
00383241   1/1  lellgprvefvegDltdp.......ealaaalaefggvdvVihlAalvhv.....dlseedpeevldvNv
00419991   1/1  .......ealaalleeigvd.aVihlAaissv.....dlseedpeevldvNvlgtlnlleaarka....g
00462911   1/1  kgDltdp...........esleealkgvkpdvvihlAaivhv.....dlseedpeetidvNvlgtlnlle
00430411   1/1  vegDltdp.......eslaealk...gvdvVihlag....................dvnvlg....tlnl
00516961   1/1  .............laealagvdvvihlagv......vrfsagdpeaflavnvdgtlnlleaaraagvk..
00519911   1/1  e....gvevvvgDltdp...........eslaaalkgvdvvinaagitrvg.......edleefldvnvd
00465291   1/1  vdrneekleelaeeieaaggkavvldvsdeedlkelv..........grlDilvnnagipl.lkplldlt
00481861   1/1  .....eslaealkg...advvviaagip.......rkpgedrldlldvnvlgvknlleaaaka.....gv
00387841   1/1  leav.......edlvealggadvvvnnagvp.......rkpgeerldllevnvlgtknlaealkka....
00519251   1/1  ......esleealkg...vdvvihlAaivgv.....dlseedpeetidvNvlgtlnlleaar......ka
00430421   1/1  dpeslaealkg.vDvVihlagl.........................evidvnvlgtlnlleaakea...
00479651   1/1  tdinpealeaaaaelgaevvsggealavacdvtdp....aavealidaavaafgkldilvnnAgiplvdp
00496861   1/1  ....veellkallklggvdvvihtag.....apvtelslsllkqllrvnvlgtlnllrallpllvklg.v
00485161   1/1  klellkelgadvvi...dvtdedaveal..........agggvdvvvnnaggatlgallel.lapggrvv
00471781   1/1  paslaaalagv.daVihlag.....................padpldllevnvdgtrnlleaakaagvk.
00367851   1/1  ..gveavelDvtdeasldaalgdaDvvinaapvglhaeiveaaleagkhvvdenpla..aetralleaak
00354771   1/1  d.galavlldltdtddlaealk..........gadvvvhlagv.......prkpgedrddllavnvlgtr
00421801   1/1  ...................qgdvsdleeleealggaDivvnatgaglpglllelllellkpggvvvdvay
00521161   1/1  pgvefvegDltdpealeeale..........gvdaVihlAalssvg....eseedppleflevNvlgtln
00429061   1/1  ----------------------------------------------------------------------
00352901   1/1  lkpgavvidvdvtdpedve....algdvaleefggvdilvnnapggvgpmt-------------------


                         +         -         -         -         -         *         -:210
query           RKVLAISSGAARNPVPGWSAYCAGKAGLDMFIRSVNTEYASVPEPRTLRAVALAPGVVDTGMQETIRGAD
00515681   1/1  .ggrivnisSvagllglpglaaYaasKaalegltrslalela....prgirvnavapglvdTpllrglla
00515111   1/1  lplmrkrgllggrivnisSvagllglpglaaYaasKaallgltrslalel......tgirvnavaPglvd
00476811   1/1  lmrkrg.ggrivnisSvagllglpglaaYaasKaalegltrslalel....aptgirvnavaPGlvdTpl
00417571   1/1  lplmrkrgllggrivnisSvagllglpglaaYaasKaallgltrslalel......tgirvnavaPglvd
00380421   1/1  glggrivnisSvagllglpglaaYaasKaalegltrslalela....prgirvnavapglvdTpllrgll
00515421   1/1  lmrkrg.ggrivnisSvagllglpgqaaYaasKaallgltrslalela....prgirvnavaPGlvdTpm
00376621   1/1  traalplmrkrg.ggrivnisSvagllglpglaaYaasKaalegltrslalela....prgirvnavapg
00471241   1/1  glggrivnisSvagllallllllglpglaaYaasKaallgltrslalel....aprgirvnavaPglvdT
00482861   1/1  lk...ggrivnvsSvagllglpglddllleelllsdllllllldlllelldlllplledtplgplaaYaa
00525291   1/1  grivnisSvagllglpglaaYaasKaalegltrslalela....prgirvnavapglvdtpllallgllg
00509671   1/1  lmlkrg..grivnisSlvagllglpglaaYaasKaalegltrslalela....prgirvnavapglvdTp
00450761   1/1  lgtflltraalplmlkr...grivnisSvaglllglpglaaYaasKaalealtrslalela....prgir
00503651   1/1  rg.ggrivnisSvagllglpglaaYaasKaalegltrslalela....pkgirvnavapglvdTpllrgl
00350181   1/1  g.ggrivnisSvagllglpglaaYaasKaalealtrslalela....prgirvnavapglvdTpllaall
00380681   1/1  lggrivnisSvagllglpglaaYaasKaalegltrslalela....prgirvnavapglvdTpllralla
00368061   1/1  krgaesgggggrivnisSvagllglpglaaYaasKaalegltrslalela....prgirvnavapglvdt
00437031   1/1  llrkrg..grivnisSvagllvglpglaaYaasKaalegltrslalela....ptgirvnavaPglvdTp
00385451   1/1  grivnisSvagllglpglaaYaasKaalealtrslalela....prgirvnavapglvatpllagl...l
00421311   1/1  edwdrvldvnllgtflltraalplmrkrsaessggggrivnisSvagllglpglaaYaasKaalegltrs
00509551   1/1  ltraalplmrkrgldggrivnisSvagllglpllglaaYaasKaalegltrslalel..llaprgirvna
00361941   1/1  grivnissvagllglpglaaYaasKaalegltrslalela....prgirvnavapglvatpllralll.l
00387701   1/1  grivnisSvagllglpglaaYaasKaalegltralalelaprg..lgirvnavapglvatpllrglllla
00486141   1/1  grivnisSvagygplpglaaYaasKaavegltrslalelapll..kgirvnavapglvdtpllra.....
00436781   1/1  krgaesglgggrivnisSvagllglpglaaYaasKaalegltrslarela....prgirvnavapglvat
00398711   1/1  grivnisSvagllglpglaaYaasKaalealtrslalel....aprgirvnavapglvatpllaglllll
00451531   1/1  mrkrg.ggrivnisSvagllglpglaaYaasKaalealtrslalela....prgirvnavapglvdTpll
00424291   1/1  grivnissvagllglpglaaYaasKaalegltrslalela....prgirvnavapglvltpllralll.l
00394381   1/1  ...grivnisSvaglllglpglaaYaasKaalealtrslalela....prgirvnavapglvdTpllagl
00503831   1/1  ervldvNllgtflltraalplllkrglggrivnisSvagllglpgqaaYaasKaalegltrslalela..
00512791   1/1  grivnisSvagllglpglaaYaasKaalegltrslalela....prgirvnavapglvdTpllrglllll
00519651   1/1  rg.ggrivnisSvagllglpgllaaYaasKaalegltrslalela....prgirvnavaPglvdtpllaa
00512601   1/1  .ggrivnisSvagllglpglaaYaasKaalegltrslalelaplg.ltgirvnavapglvdtpllaalla
00413661   1/1  grivnisSvagllglpglaaYaasKaalegltrslalela....prgirvnavapglvdtpll.......
00369221   1/1  g.ggrivnisSvagllglpgqaaYaasKaalealtrslalela....prgirvnavapglvdtpllaal.
00354711   1/1  ag..grivnisSvaglgglpglaaYaasKaalegltrslarel....ap.girvnavapglvdtpllrgl
00506551   1/1  mkks...grivnisSiagllglpdlglllleelllddlllldllellslllelllealleelllglaaYa
00388141   1/1  grivnisSvagllglpgqaaYaasKaalealtrslalela....prgirvnavapglvatpllaal...l
00510061   1/1  plmlkrg..grivnisSlvagllglpglaaYaasKaalegltrslalela....prgirvnavapglvdT
00383421   1/1  lmrkrg.lgrivnisSvagllglpgqaaYaasKaalegltrslalel....aprgirvnavapglvatpl
00507761   1/1  rkrg.ggrivnisSvagllglpglaaYaasKaalegltrslalela....prgirvnavapglvdTpllr
00513551   1/1  galssgellslgggrivnisSiagllglpglgllelplaaYaasKaalegltrslalela....pkgirv
00517021   1/1  grivnisSvagl.glpglaaYaasKaalegltrslalela....prgirvnavapglvdtpllaal...l
00517631   1/1  grivnisSvaglllglpglaaYaasKaalegltrslalela....prgirvnavapglvdtpllrgllpl
00416101   1/1  lggrivnisSvagllglpglaaYaasKaalegltrslalelllap....rgirvnavapglvdtpllagl
00532861   1/1  g.ggrivnisSvagllglpglaaYaasKaalegltrslalela....pkgirvnavapglvdTpllrgll
00498451   1/1  gaasgggggrivnisSvagllglpglaaYaasKaalegltrslalela....prgirvnavapglvdtpl
00502371   1/1  g.ggrivnisSvagllgglpglaaYaasKaalegltrslalela....prgirvnavapglvdTpllagl
00520851   1/1  lpllrkrg.ggrivnisSvagllglpglaaYaasKaalegltrslalela....prgirvnavapglvdt
00510931   1/1  ltraalp.mlkrg.ggrivnisSvagllglpglaaYaasKaalegltrslalelaprg..lgirvnavaP
00514401   1/1  gtflltraalpllrkrg.ggrivni.SvagllglpgqaaYaasKaalegltrslalela....prgirvn
00409101   1/1  rglglggrivnisSvagllglpglaaYaasKaalegltrslalela....ptgirvnavapglvdTellr
00416921   1/1  grivnissvagllglpglaaYaasKaalegltrslalela....prgirvnavaPglvdTpllagll..d
00464831   1/1  sledwer.ldvNllgvflltkaalplmkkaaklskrg.ggrivnisSvaglrglpglaaYsasKaalegl
00353051   1/1  rglglggrivnisSvagllglpglaaYaasKaalegltrslalela....ptgirvnavaPglvdTplla
00482431   1/1  lltraalp...llrggglssglggrivnisSvagllglpglaaYaasKaalegltrslalela....prg
00499421   1/1  grivnisSvagl.glpgqaaYaasKaalegltrslalela....prgirvnavapglvdtpllaalleel
00385591   1/1  grivnissvaglgglpglaaYgasKaavegltrslalelapll..kgirvnavapgnvdtpmlrg.....
00474701   1/1  rkrg.ggrivnisSvagllglpglaaYaasKaalegltrslalela....prgirvnavapglvdTpllr
00499431   1/1  lm...rgggrivnisSvagllglpglaaYaasKaalegltrslalela....pkgirvnavaPglvdTpl
00529881   1/1  re.g..gsivnissv.gllglpglaayaasKaalegltrslalela....prgirVnavaPgpirTplla
00511091   1/1  flltraalp.lrkrgl.grivnisSiagllglpgqaaYaasKaalealtrslalelall..prgirvnav
00519551   1/1  plmkkrg.ggrivnisSvagllglpglaaYaasKaalegltrslalela....pkgirvnavapglvdtp
00425051   1/1  grivnisSvaglvglpglaaYaasKaallgltrslalela....prgirvnavaPglvdTpmlaalllgl
00532661   1/1  lplm...rgggrivnisSiagllglpglaaYaasKaalegltrslalela....pkgirvnavapglvdT
00523681   1/1  g.ggrivnisSvagllglpglaaYaasKaalegltrslalela....pkgirvnavaPglvdtpllrgll
00500221   1/1  grivnisSvagllglpgqaaYaasKaalealtrslalel....aprgirvnavapglvdtpllaalleel
00528731   1/1  krglggggrivnisSvagllglpglaaYaasKaalegltrslalllela....ptgirvnavapglvrtp
00527441   1/1  aalpl.....gvgrivniSSiagvlgspgqsaYaasKaalealtrslaae........girvnavrpglv
00468011   1/1  ggrivnisSlavygalldlpllelllllllldlledvaglrglplglaaYaasKaalegltrslalela.
00465921   1/1  plldlsledwdrvldvnllgvflltraalplm...rgggsivnissvaglvglpglalayaasKaAlegl
00489491   1/1  ltkaalplm...rgggrivnissvagllglpglaaYaasKaalegltrslalela....pkgirvnavaP
00494281   1/1  gaakksgeglslsralivnissllGsigdntsgglyaYrasKaALnmltkslaiel....kd--------
00512031   1/1  kaalplm.krgg.grivnisSiagllglpgqaaYaasKaalegltrslalelll..apkgirvnavaPGl
00499021   1/1  plldlsledwdrvldvnllgvflltkaalplmkk...ggsIvnissiaglrglpglalayaasKaAlegl
00483611   1/1  plldlsledwdrvldvnllgvflltqaalplmkk...ggsIvnissiaglvglpglalayaasKaAlegl
00490261   1/1  gtlnlleaalpa.....gvggrivfvSSiavygdpdgpidEddlllvllllllllltplpplsaYgasKa
00495191   1/1  lpagvksg..grivniSSiavygdpeglpidEdtplpplspYgasKaaaeallralarel.......gir
00480351   1/1  rvldvnllgtflltraalplmlarg..grivnissiagllglpglaaYaasKaallgl------------
00507211   1/1  ....rkagtvgrivnvSS.agvygdpglggpidEddpldplspYgasKaaaeallralarelaptgllle
00465741   1/1  pa.....gvgrivfvSSiavygdpdglpidEgdpglpplspYgasKaaaelllralare......gsgir
00460341   1/1  gvkrggggglslrivfiSsiavygglpgqsgpitEddpldplspYgasKaaaeallralarel.......
00482931   1/1  pagvkrggggrivniSSi.gvygdpggpidEddplnplsaYgasKaaaeallralarel.......girv
00468971   1/1  ggggglslrivfvSSiavyggpggllevllesllgpldeddplnplspYgasKaaaeallralarel...
00493571   1/1  vNvlgtlnlleaalpa.....gvgrivniSSi.gvyggpggapidEddplnplspYgasKaaaeallral
00511831   1/1  lleaarka....gsvkrivfvSSiaavygdplllpglpidEdtwldvdllaalllllelplpplspYgas
00514911   1/1  .gvgrivfvSSiavyggllllppglpidEddplnplspYgasKaaaelllralare.ap....ygirvti
00498641   1/1  g.vgrivfiSSaavyggseegpidEddpldpplspYgasKaaaellaralarel......ygirvvilrp
00532871   1/1  aakaagvk.....rivlvSslgayggdedtplpplspygasKaaaeallra...........sglrvtil
00433371   1/1  vvgrivfvSSaavyggppglpidEdtplnplspYgasKaaaellaralare.......yglrvvilrpgn
00491171   1/1  a.....gvgrivfvSSigvyggpgglpidEdtplpplspYgasKaaaeallralarel.......glrvt
00464721   1/1  vkrivfvSSiavyggpgglpidEddllllplnplsapYgasKaaaelllralarel.......glrvtil
00371281   1/1  gvrfvytSSaavyggppglpidEdtplnplspYgasKaaaellvralare.......yglrvvilrpgnv
00527221   1/1  aeaakkagvk.....rfvlvSslgalgpspsp..yaasKaaaeallral...........glprvtivrp
00400431   1/1  gv..rfvfiSSaavyggspllllllglllldglpidEdtpldplspYgasKaaaellvrayare......
00383241   1/1  lgtlnlleaarka.....gvkrfvfaSSaavyggnplllllddelpidEddplnplspYgasKaaaeklv
00419991   1/1  vkprfvfiSSaavyggspgqpldesllldvdllpllaitEdtplnplspYaasKaaaealarayare...
00462911   1/1  aarkagvksg..grfvfiSSsavyggppglpidEddplnplspYgasKaaaelllrayakey.......g
00430411   1/1  leaakkag.vkrfvfvSsagvygdedtplpplspygasKaaaeallral...........glpvtivrpg
00516961   1/1  ...rfvlvSslgaygd..plspyarsKaaaeallral...........glprvtilrpglvygprdgfll
00519911   1/1  gtlnlldaakkagvk.....rfvlvSslgalgpspsp..yaasKaaaeallral...........gldlv
00465291   1/1  kegwdvidvgvldvnllgvfllak----------------------------------------------
00481861   1/1  grivlvssnpvdgl.....ayaaskaaleg...............sgldvnrvrP---------------
00387841   1/1  .gpgrivvvsspagllglpalkvygaska-----------------------------------------
00519251   1/1  gvrfvfiSSsavygdpkkgpidEddllllnplnplspYgasKlaaekllrayakey..------------
00430421   1/1  .gnvkrfvfvSsagvygdedtplnplspygasKaaaekllra...........sglpvtilrpgnvygpg
00479651   1/1  eallillergilyaPdilanAggv----------------------------------------------
00496861   1/1  krivyissvgvvtplrglspYsasKaaleg----------------------------------------
00485161   1/1  lvnllggllltrallplllkrgkgrivns............-----------------------------
00471781   1/1  ....rlvlvssagaygdepgpplplspyaaskaaaeellra...........sgldytilrpgalfgpg.
00367851   1/1  eag.vgrivnvssaagyadgrglpayqaakaalealllglalel....giagirvnailpgf--------
00354771   1/1  alleaarka.....gvgrivvvssgnpvd-----------------------------------------
00421801   1/1  ppllttallplararglg.rivdglsmlvlqgapgfely-------------------------------
00521161   1/1  lleaarka.....gvkrfvfaSSsavygdpeglpidEdtlldvdleplnplspYgasK------------
00429061   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FAQVQRFRDLKDNEQLASPDDTARRIVAYLARPDFGTTELDDIRKY------------------------
00515681   1/1  llllllllllllllpeevaeallaliplgrl---------------------------------------
00515111   1/1  Tdllaallldllleelleallaliplgrlgtpe-------------------------------------
00476811   1/1  lrallaalallllllllllldllelleallalip------------------------------------
00417571   1/1  Tdllaalllglldpelleallaliplgrlgtpe-------------------------------------
00380421   1/1  l.deelleallaliplgrlgtpeevaeavlflasdeas--------------------------------
00515421   1/1  taalle.............plgrlgtpeevadav------------------------------------
00376621   1/1  lvdTpllagll..peelleallaliplgrlgtpeevae--------------------------------
00471241   1/1  pllaglpeelleallaliplg...rlgtpeevadavlf--------------------------------
00482861   1/1  sKaalegltrslarelllllapkgirvnavaPg-------------------------------------
00525291   1/1  peellelllalip.rlgtpeevadavlflasda-------------------------------------
00509671   1/1  llrgllalllllllllelleallaliplgrlgt-------------------------------------
00450761   1/1  vnavapglvdTpmlaalllllllllllilvleelleal--------------------------------
00503651   1/1  lgllallllllpeevaeallkliplgrlgt----------------------------------------
00350181   1/1  lllllleelleallaliplgrlgtpeevaeavlflasd--------------------------------
00380681   1/1  lllllllllleevlealldliplgrlgtpedvae------------------------------------
00368061   1/1  pllagllg..eellelllaliplgrlgtpeevaeavl---------------------------------
00437031   1/1  llrgllllllllllleelleallaliplgrlg--------------------------------------
00385451   1/1  pellelllaliplgrlgtpeevaeavlflasdea------------------------------------
00421311   1/1  lalela....prgirvnavaPglvdTpmlral.-------------------------------------
00509551   1/1  vapglvdtpllralleelleallaliplg...rl------------------------------------
00361941   1/1  eelleallaliplgrlgtpedvaeavlflasdpa------------------------------------
00387701   1/1  lleellallldgiplgrlgtpedvaeavlflasd------------------------------------
00486141   1/1  ......lgdgtplgrlgtpedvaeavlflasdaas-----------------------------------
00436781   1/1  pllagllg..eellealldliplgrlgtpedvaeavlflasd.---------------------------
00398711   1/1  lllllllleellealldgiplgrlgtpedvaeav------------------------------------
00451531   1/1  aallllllleelleallaliplgrlgtpeevaeavlfl--------------------------------
00424291   1/1  eellaallaliplgrlgtpedvadavlflasdpa------------------------------------
00394381   1/1  lalllllllllllpeelleallaliplgrlgtpe------------------------------------
00503831   1/1  ..prgirvnavapglvdTpllrgllllpee----------------------------------------
00512791   1/1  llleelleallaliplgrlgtpeevadavlflasdasyvtgqv---------------------------
00519651   1/1  llldleelleallalillplgrlgtpedva.davlf----------------------------------
00512601   1/1  a.............lgrlgtpedvaeavlflasdeasyi-------------------------------
00413661   1/1  .eallellaliplgrlgtpeevaeavlflasdea------------------------------------
00369221   1/1  ..leelleallaliplgrlgtpeevaeavl----------------------------------------
00354711   1/1  llpllllalllgellevlgdgiplgrlgtpedvada----------------------------------
00506551   1/1  asKaalegltrslalelllllapkgirvnav---------------------------------------
00388141   1/1  eellelllaliplgrlgtpeevaeavlflasdda------------------------------------
00510061   1/1  pllrglla.peelleallellellldliplgrlgtp----------------------------------
00383421   1/1  terllrl.............gllllspeevaeallaal--------------------------------
00507761   1/1  gllallllllllllpeevaealldliplgr----------------------------------------
00513551   1/1  navapglvdTpllrgl..................Allt--------------------------------
00517021   1/1  eelleallaliplgrlgtpeevaeavlflasdeasyit--------------------------------
00517631   1/1  lllpeelleallaliplgrlgtpedvadav----------------------------------------
00416101   1/1  lp..eellelllaliplgrlgtpeevaeavlfla------------------------------------
00532861   1/1  ..deelleallkliplgrlgtpeevadavl----------------------------------------
00498451   1/1  lagllp..eellallldgiplgrlgtpedvadavlflasd.sy---------------------------
00502371   1/1  lld.eelleallaliplgrlgtpeevadavlf--------------------------------------
00520851   1/1  pllaal...leelleallaliplgrlgtpe----------------------------------------
00510931   1/1  GlvdTpllrgllae...........iplgrlgtp------------------------------------
00514401   1/1  avaPglvdTpllaalllllpeellealldl----------------------------------------
00409101   1/1  alllllalleelleallaliplgrlgtpeevae-------------------------------------
00416921   1/1  eellelllaliplgrlgtpeevaeavlflasda-------------------------------------
00464831   1/1  trslalela....pkgirvnavaPGllvdT----------------------------------------
00353051   1/1  glll.dpelleallaliplgrlgtpeevaeavlflasdyvtgqv--------------------------
00482431   1/1  irvnavaPglvdTpll.....lpeelleal----------------------------------------
00499421   1/1  leallaliplg...rlgtpeevadavlflasdeasyit--------------------------------
00385591   1/1  ......lldgtplrrlgtpedvaeavlflasdea------------------------------------
00474701   1/1  gllpllllllpeevleallaliplgrlgtp----------------------------------------
00499431   1/1  lrglllle.elleallkliplgrlgtpeev----------------------------------------
00529881   1/1  allaalaallllllleelleallaliplgr----------------------------------------
00511091   1/1  aPGlvdtp....................------------------------------------------
00519551   1/1  mlaallle............plgrlgtpee----------------------------------------
00425051   1/1  llllleelleallaliplgrlgtpeevadavlf-------------------------------------
00532661   1/1  pllrglllpe.elleallkliplgrlgtpe----------------------------------------
00523681   1/1  lllllpeelleallkliplgrlgtpeevad----------------------------------------
00500221   1/1  leallaliplg...rlgtpeevadavlflasdea------------------------------------
00528731   1/1  llagllpllllllleellealldliplgrlgtpedvaeavlfl---------------------------
00527441   1/1  atp......glveellaellariplgrl.tpedva-----------------------------------
00468011   1/1  ...prgirvnavaPglvdTpllrgllal.eell-------------------------------------
00465921   1/1  trslalelapr...lgirVnavaPgpi-------------------------------------------
00489491   1/1  glvdTpllrglllle.elleallkliplgr----------------------------------------
00494281   1/1  ----------------------------------------------------------------------
00512031   1/1  vdtpllaalllalalllllllalallllaal---------------------------------------
00499021   1/1  trslalela....prlgIrVnavaPGpikTp---------------------------------------
00483611   1/1  trslalelapr...lgIrVnavaPgpiltpm---------------------------------------
00490261   1/1  aaelllralarel.......girvtilrpgnvygpglr--------------------------------
00495191   1/1  vtilrpgnvygpggrpllvtsllplflrlalaggplplvlgd----------------------------
00480351   1/1  ----------------------------------------------------------------------
00507211   1/1  lgirvtivrpgnvygpglgfpgnllplllraa--------------------------------------
00465741   1/1  vtilrpgnvygpglspllgelllgvpdsllplflraal--------------------------------
00460341   1/1  girvtilrpgnvygpg.ggpgnllplllraalaglp----------------------------------
00482931   1/1  tilrpgnvygpggrp.glvtsllplflrlalaglpltlvlgd----------------------------
00468971   1/1  ....girvtilrpgnvygpggrp.gnllplllraal----------------------------------
00493571   1/1  arel.......girvtivrpgnvygpglrplgvtg-----------------------------------
00511831   1/1  Kaaaealaralarel....ap.glrvvilrpgnvy-----------------------------------
00514911   1/1  lrpgnvygpllsgllgelllgvpgsliplllraalg----------------------------------
00498641   1/1  gnvygpglrpllgedplgalggllplllraal--------------------------------------
00532871   1/1  rpglvlgpllsg...lrlggllllgdgdalrsfi------------------------------------
00433371   1/1  vygpggrpdgvtsnliplllrlalggepltvlgdgdqvrdfv----------------------------
00491171   1/1  ilrpgnvygpgggp.gnllplllraalaglpltvlg----------------------------------
00464721   1/1  rpgnvygpggrpllglsgvlprlirlallaalaglp----------------------------------
00371281   1/1  ygpggrpdgltssviplllrlalagepltlvlgdgdqlrdfi----------------------------
00527221   1/1  glvlgplgeplpgelllaggllllgdgdakrspisvddva------------------------------
00400431   1/1  .yglrvvilrpgnvyGpggrpe.sliplllraalkggp--------------------------------
00383241   1/1  rayare.......yglpvvilrpgnvyGpggsp-------------------------------------
00419991   1/1  ....yglrvvilrpgnvyGpggrp.glpsgvlp-------------------------------------
00462911   1/1  lrvvilrpgnvyGpgggpdgvtskviplliraalkgkp--------------------------------
00430411   1/1  nvygpglsgiplllrlalkggpllilgdgdakrd------------------------------------
00516961   1/1  allll.llllgdgdqrrspihvddvaralvaalld-----------------------------------
00519911   1/1  tivrpglvlgpllspllgealllpgllllgdgdakrrpisved---------------------------
00465291   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00519251   1/1  ----------------------------------------------------------------------
00430421   1/1  lsgliplllklalkggpllilgdgdqkrdfihv-------------------------------------
00479651   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00485161   1/1  ----------------------------------------------------------------------
00471781   1/1  ......rtgvllllgdgdglrslisvddvAaalvl-----------------------------------
00367851   1/1  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00521161   1/1  ----------------------------------------------------------------------
00429061   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------