[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF07939.1


[Show Plain Result]

## Summary of Sequence Search
   1::289
   1::281    1e-98 54.2% 0048496 00484961 1/1   ase                                     
  12::275  2.7e-85 45.5% 0046878 00468781 1/1   ase                                     
   1::283    5e-85 40.1% 0046288 00462881 1/1   ase                                     
   2::277  2.1e-73 32.1% 0046975 00469751 1/1   ase                                     
   5::275  6.5e-71 35.8% 0049279 00492791 1/1   ase                                     
   7::285  2.8e-68 42.4% 0051114 00511141 1/1   ase                                     
   1::276  6.8e-59 33.1% 0047183 00471831 1/1   ase                                     
   1::278  1.2e-56 35.5% 0050239 00502391 1/1   ase                                     
   1::289


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKLCGFDVGLDKPFFLIAGPCVIESEQMALDTAGELKAITGELGIPFIYKSSFDKANRSSGKSFRGLGME
00484961   1/1  edtvvkigdiliggdkpllliaGpcvieseelaleiAealkelaeelgiplvrkgsfkkapRTspysfrg
00468781   1/1  -----------drllviaGpCsieseeaaleyaerlkelgaklldillivlrsyakkpRtsvgsfkGlgl
00462881   1/1  vlnsrikignilignddrllviaGpcsieseeaaleyAkrlielakklgldivfkvsfekpnrtsvdsfk
00469751   1/1  -dlrilgikplispaelleelPlseellelvlesreeildillgeddrllviaGPCsiedeeaaleyaer
00492791   1/1  ----gvligddrplvia.Gpcsieslelalelaealkea....gadavrfgtfk..prtsvysfqglgle
00511141   1/1  ------lvlelikivsrligeddpllvIaeigvnhngdlelakeliliAgpcgaesvkfqlltaetl...
00471831   1/1  veivdillggddrllviaGPCsiedeeaaleyAerLkelgaklkddllivlRvyfeKPrttvg..fkGli
00502391   1/1  keikignlligndkplfiiAEiGpnhngslelalklidaakeagadavKfQtytadtlvlkidylrkgsf


                         -         -         *         -         -         -         -:140
query           KGLEILATVKRQIGVPVLTDIHEIDEIKPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPVNIKKGQFLAP
00484961   1/1  lgleeglkilaevkeelglpvvtevhdpeqvelvaevvdvlqigArlmrntdlleavaktgkpvllkkgq
00468781   1/1  eegldilaevkeelglpvatevldpiqvelvadlvdvlqigArltentdlleaaagtgkpvllKkGtflt
00462881   1/1  glgleeglklllevaeelglpvltevldpisvdlladlvdvlqIgArltentdllrevAstgkpvllkng
00469751   1/1  LkelaeklkdgllivmrvyfeKPrttv..gwkGlindPdldgsfdieeGLkilrkllldlaelglpvate
00492791   1/1  .glkilrelleelglpvltevldpesvdlladlvdilqigArnmtnfdlleaaaktgkpvllkrGmsatl
00511141   1/1  vkklgi.lilkgsadk.prtslysflglgle.glkiLaevaeelglpvltevfdlesvdllaelgvdvlk
00471831   1/1  ndPdldgsfdieeGLkilrkllldleelglpvatEvldpispqyvadlvdwlaIGArttesqlllelasg
00502391   1/1  dkalnrtslysflglgle.glkiLkeyckelgipflttvfdlesvdllaelnvdilkiasfeltnlpllk


                         +         -         -         -         -         *         -:210
query           HDMKNVIDKARDAAREAGLPDDVFMACERGVSFGYNNLVSDMRSLAIMRETGAPVVFDATHSVQLPGGQG
00484961   1/1  fltleemlnaaekilsa....Gndn..vilcerGistgynrlvldlralpvlkelltglPvivDpsHavq
00468781   1/1  leealnave....kiltaGnpn..vilieRGgstgpnylvldlralpvlle.glpvivDashsvslkggl
00462881   1/1  tsasleealnavek....iltaGnpd..iillergssypynylvvdlraipilkklflglpvivDasHsn
00469751   1/1  vldpitpqyvadlvdwlaiGArttesqlllelasglskPvglKngtdgnlevalnailaasaphlflgvn
00492791   1/1  eeilnAv....eyilsagnpn..villerGirtfypytrnvvdlraipllkelfglpvivDpsHgl....
00511141   1/1  igafeltntdllravaktgkpvilktG.matleeillavekl....reagn.dlvllrctrgyptpyen.
00471831   1/1  lskPvglKngtdgtlevaldAilaasaphfflgvdkegvaeivlts....Gnpd..vhlilRGgrtgpny
00502391   1/1  aiaktgkpvilstG.mstleeilnavekl....lkagnkniiLl...hcts.gYptlvedvnlraipilk


                         -         -         -         +         -         -         -:280
query           TSSGGQREFVPVLSRAAVATGVAGLFMETHPDPSKAMSDGPNAVPLSRMKELLTVLRDLDGMVKRAGFLE
00484961   1/1  lpgglgdssgGlrelvlplaraavaaGadGlfiEvhpdPdkalsdgpqalpldeleelleelraidelvk
00468781   1/1  gqlsvgrrvlvlalaraavalgadGlmiEsHldpdnalsDgpqslpldeleellyglsitdaclg-----
00462881   1/1  slkgglsdhtlgvrelvlalaraavalgadGlmiEsHldpdnalsdgpqsltlgsltdllidlkatekll
00469751   1/1  keGlaaivlttGnpdvhlilRGgsfpnydlvslalalvllakaglnlpvvvDasHsn.........s---
00492791   1/1  .......sdhelvlqlavaavalgadGlmiEvHltpdkalsDgpqslepdeleelveeiraieea-----
00511141   1/1  .ldlraipvlkelflpvivglSdHslglp................laraAvalG..alfiEkHftpdkal
00471831   1/1  lvldlaavplllekaglPvivDasHa...........ngnkdlvrqlavledvleqraagaagidG----
00502391   1/1  klfglpvigdsdHsl..lg.............illalaAvalGa..liiEkHftldkalsgpDgaasl--


                         -         *         -         -         -         -         +:350
query           DNFGWPACA-------------------------------------------------------------
00484961   1/1  s---------------------------------------------------------------------
00468781   1/1  ----------------------------------------------------------------------
00462881   1/1  gsl-------------------------------------------------------------------
00469751   1/1  ----------------------------------------------------------------------
00492791   1/1  ----------------------------------------------------------------------
00511141   1/1  sgpDg-----------------------------------------------------------------
00471831   1/1  ----------------------------------------------------------------------
00502391   1/1  ----------------------------------------------------------------------