[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF07996.1


[Show Plain Result]

## Summary of Sequence Search
   1::397
  25::276  2.6e-67 38.9% 0038618 00386181 1/1   inding barrel                           
  18::275  2.4e-59 36.2% 0049723 00497231 1/1   inding barrel                           
  25::276  2.7e-55 41.4% 0040168 00401681 1/1   inding barrel                           
  25::275  4.8e-55 38.6% 0053309 00533091 1/1   inding barrel                           
  25::275  2.1e-53 40.0% 0053370 00533701 1/1   inding barrel                           
  25::275  5.4e-51 37.7% 0046278 00462781 1/1   inding barrel                           
  25::251  3.4e-35 35.4% 0050171 00501711 1/1   inding barrel                           
 239::393  8.7e-35 31.2% 0046698 00466981 1/1   ne racemase C-terminal domain-like      
 245::393  1.6e-33 32.2% 0047840 00478401 1/1   ne racemase C-terminal domain-like      
 233::398  1.7e-33 28.3% 0053369 00533691 1/1   ne racemase C-terminal domain-like      
  25::255  2.7e-23 28.1% 0045930 00459301 1/1   inding barrel                           
 240::397  1.1e-14 22.4% 0044144 00441441 1/1   ne racemase C-terminal domain-like      
  24::250  5.1e-14 33.3% 0049144 00491441 1/1   inding barrel                           
 231::393  1.3e-10 24.2% 0038617 00386171 1/1   ne racemase C-terminal domain-like      
   1::397


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDLTHVTRYIAGRDTREPVCAYLYDLDDLRLRTTRLRAALPEQCALYYAVKANSDAPVLRALLGVADGFE
00386181   1/1  ------------------------dldalrrnirrlraalpggvrlvyavKanplpavlellaelglgle
00497231   1/1  -----------------gtPlyvydldalreniralkeafpggvkvfyavKanpnpavlkllaelgagfd
00401681   1/1  ------------------------dldaLrrnlealkaalp....lvyAvKanslpavlellaelglgle
00533091   1/1  ------------------------Dldalrrnlralkealp.gvkilyAvKansnpavlrllaelgagfd
00533701   1/1  ------------------------Dldalrrnlralkeafp.gvkvlyAvKansnpavlrllaelgagfd
00462781   1/1  ------------------------Dldalrrnlralkeafp.gvkilyAvKansnpavlellaelgagfd
00501711   1/1  ------------------------Dldalrhniralreaag.gvkllavvKanAYGhgalavaralleaG
00466981   1/1  ----------------------------------------------------------------------
00478401   1/1  ----------------------------------------------------------------------
00533691   1/1  ----------------------------------------------------------------------
00459301   1/1  ------------------------idldalrhniralkelagrgvkllavvKanAYGhgaveiakallea
00441441   1/1  ----------------------------------------------------------------------
00491441   1/1  -----------------------IdldalrhNlrllrellp..vkllavvKanAYGhgavevakallaga
00386171   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VASFGEIERVRGVDAEVPIAFGGPGKTDAELEGALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRA
00386181   1/1  vaskgElllalaagvpperiifagplksreelrlalelgvrlivvdsleeleklaalapelgvplrvllr
00497231   1/1  vaslgElllalaagvpperiifagpgksreeielalelgvliivvdsleelellaelapelgkvakvllr
00401681   1/1  vaSlgElllalalgvplelspdeiifagpaksdeeielalglgv.livvdsldelerllel....gpklk
00533091   1/1  vaslgElllalaagvpperiifagpakseeeirlalelgvrlivvdsleelellaelape....akvglR
00533701   1/1  vaslgElllalaagvppe.riifsgpaksreeielalelgvllivvdslselellaelape....akvgl
00462781   1/1  vaslgElllalaagvpperiifsgpaksreeirlalelgvllivvdslselellaelape....agvllr
00501711   1/1  argfgvaslqEalalreagidapilflgplqsn.klklaaelgl.iltvdslellealseaaaelgkplr
00466981   1/1  ----------------------------------------------------------------------
00478401   1/1  ----------------------------------------------------------------------
00533691   1/1  ----------------------------------------------------------------------
00459301   1/1  GargfgvatvqEalelreagidipllllgplqsn.klklaaeldl.ihsvdslklaealskaaak.gkpl
00441441   1/1  ----------------------------------------------------------------------
00491441   1/1  dgfavatleEalalreagidapilvlgglfspeelellveldltlv.vdsleqlealseaal..gkplkv
00386171   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NPAYGLPGATLQMGGGATQFGIDEALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALA
00386181   1/1  vnlgasagtgdllstgglgskfGlspeellellellkeakllglrlvglhfhvgsqildaealvealrea
00497231   1/1  inpgvdagthdyistggldskfGidleegealellelakelpglelvGlhfhigsqildleafrealerl
00401681   1/1  vglRvnlsvslgagsllssggesskfGlsldelvellellre.lllrlvglhfHvgsqildadlfveala
00533091   1/1  vnpgvd.....agthgliskfGidleealellelakelg.ldlvglhfHigsqildleallealrrllel
00533701   1/1  Rvnpdvdagthplis.....kfGidleealellelakelg.ldlvglhfhigsqildleallealrrlla
00462781   1/1  vnpdvd.....agthgliskfGidleealellelakelg.ldlvglhfHigsqildleallealerllel
00501711   1/1  vllkvd.............tgmsRlGvspeelgealelleaiaalpglrlvGlmthlglsdeldleafra
00466981   1/1  ----------------------------------------------------------------------
00478401   1/1  ----------------------------------------------------------------------
00533691   1/1  ----------------------------------------------------------------------
00459301   1/1  kvllqvd.............tgmsRlGvlpleellelleailalpnlrlvglmthlaladepdleatraq
00441441   1/1  ----------------------------------------------------------------------
00491441   1/1  hlkvDtGmg.............RlGlspeellallellaalpglrlvglmthfasadeldleltlaqlel
00386171   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KRLRDLHGLTLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVA
00386181   1/1  lelfvelaeklleelglplevldlGGGlgvdylgsdvnydleeyaaavrallkelfdelglpgprl----
00497231   1/1  leladelke.lgidlelldlGGGlgipylsgdvpldleeyaeavraalkelfeglpgpelilEpG-----
00401681   1/1  lalell.....elgldldlldlGGGlgvdylgtsvnydleeyaaalvallkellelllpgvelilE----
00533091   1/1  aerlre.lgidlelldlGGGlgipyseg...ydleeyaaaivaalkelfdelpgpelilEpGral-----
00533701   1/1  laeelre.lgldlklldlGGGlgipy...dgpydleeyaaaivaalkelfdglpgpelilEpGra-----
00462781   1/1  fdelre.lgldlelldlGGGlgipy...depydleeyaaaivaalkelfdelpgpelilEpGral-----
00501711   1/1  qlarlleladllka.lgldleilslggsagill.aielgat-----------------------------
00466981   1/1  ----------------------------klldlaaliealkellgklgle.....E.Graflva.agvlv
00478401   1/1  ----------------------------------paalaallllllglpglelilEpGRy.vanagvlvt
00533691   1/1  ----------------------ssldkaldallallalilallleelglgkleliiEpGRylvanagtll
00459301   1/1  falfkelaekl....glkllilsmgnSadill.aielgatlvRpG-------------------------
00441441   1/1  -----------------------------llgndtveikdgrffidgddalelieetgrplvesagtlla
00491441   1/1  flell.......glllllvslanSagilllpe.ahfdlvR------------------------------
00386171   1/1  --------------------neglplapkvgnvvgaedelaelllegrPlleliletgkalvesavl.la


                         -         *         -         -         -         -         +:350
query           EVIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVTLCGELCTPKDVL
00386181   1/1  ----------------------------------------------------------------------
00497231   1/1  ----------------------------------------------------------------------
00401681   1/1  ----------------------------------------------------------------------
00533091   1/1  ----------------------------------------------------------------------
00533701   1/1  ----------------------------------------------------------------------
00462781   1/1  ----------------------------------------------------------------------
00501711   1/1  ----------------------------------------------------------------------
00466981   1/1  tkVldikevlldlldldleesvnggknfvivdaGmydllrpalydayhpipllllnrlpdepl......e
00478401   1/1  rVlavkevggrtfvivdgGmndllrpalydayhpivlllke....glpradgelepvtvvGplCesgDvl
00533691   1/1  trVidvkdsggkdleddedegevelvflivdaGlnhllrpalydlihpvlvllngr......edsaelkl
00459301   1/1  ----------------------------------------------------------------------
00441441   1/1  evvskreeeetlmvyiddGvygslrpalydayhvvallkkad..........etepssivGptCdslDvi
00491441   1/1  ----------------------------------------------------------------------
00386171   1/1  evelvkeldlsegdgtvlvyvdaGryglirpalydavhpvvlasrrddd........lavpvslvGplCe


                         -         -         -         -         *         -         -:420
query           AREVPVDRLRVGDRIAFTMAGAYGWHISHHDFLSHPHPERVFIGGQP-----------------------
00386181   1/1  ----------------------------------------------------------------------
00497231   1/1  ----------------------------------------------------------------------
00401681   1/1  ----------------------------------------------------------------------
00533091   1/1  ----------------------------------------------------------------------
00533701   1/1  ----------------------------------------------------------------------
00462781   1/1  ----------------------------------------------------------------------
00501711   1/1  ----------------------------------------------------------------------
00466981   1/1  pysivGptCesgDvlakdrllpelkvGDllvfldaGAYgmsms---------------------------
00478401   1/1  akdeggellerllpelevGDllvfldaGAYgasmss.nfngrp---------------------------
00533691   1/1  tsiaGplCdsgDvLaenillPelkvGDlllildaGAYtlslss.rFng----------------------
00459301   1/1  ----------------------------------------------------------------------
00441441   1/1  vedyeLPelevGDvlaiedvGAYgvalas.nfNgfprpelvlvsgrs-----------------------
00491441   1/1  ----------------------------------------------------------------------
00386171   1/1  sgDiivervsLPdllepGDvvvfentGAYgvslas.ryngfpr---------------------------