[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF08007.1


[Show Plain Result]

## Summary of Sequence Search
   1::1044
 295::497  1.3e-47 42.5% 0039248 00392481 1/2   drug efflux transporter AcrB transmembr 
 801::1029 8.2e-43 30.9% 0039249 00392492 2/2   drug efflux transporter AcrB transmembr 
 828::1024 7.6e-42 31.0% 0039248 00392482 2/2   drug efflux transporter AcrB transmembr 
 268::502  9.4e-35 29.6% 0039249 00392491 1/2   drug efflux transporter AcrB transmembr 
  38::133  2.8e-24 38.5% 0047456 00474561 1/1   drug efflux transporter AcrB pore domai 
 134::329  1.1e-20 32.4% 0047457 00474571 1/1   drug efflux transporter AcrB pore domai 
 669::853  1.3e-19 37.4% 0047459 00474591 1/1   drug efflux transporter AcrB pore domai 
 181::272  1.7e-19 42.4% 0039246 00392461 1/2   drug efflux transporter AcrB TolC docki 
 719::806  2.5e-18 37.5% 0039247 00392472 2/2   drug efflux transporter AcrB TolC docki 
 719::806    7e-18 36.8% 0039246 00392462 2/2   drug efflux transporter AcrB TolC docki 
 181::272  4.5e-15 40.2% 0039247 00392471 1/2   drug efflux transporter AcrB TolC docki 
 561::652  5.3e-12 33.7% 0047458 00474581 1/1   drug efflux transporter AcrB pore domai 
   1::1044


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAQFFLRRPAFAWVLAILTMVAGLVALNSIPVAQYPAVAPPTVILYADYPGATARTVEDRVTAVLEQQMH
00392481   1/2  ----------------------------------------------------------------------
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00474561   1/1  -------------------------------------itipvvvvtttypGaspeeveelvtlplEeals
00474571   1/1  ----------------------------------------------------------------------
00474591   1/1  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GIPGLLYIDSSSEAGTATVTIGFRQGTDPQLAQVNVRNRVSQAEPLLPEVVRRGGVYVDQASASPFMYVS
00392481   1/2  ----------------------------------------------------------------------
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00474561   1/1  gvegvkyirStssseglsvitvefelgtdldlalvevrnkvnaalssLPegvepplvlkldld-------
00474571   1/1  ---------------------------------------------------------------gllpvll
00474591   1/1  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LISKTGTMSETALADYAAGTVLPMLRRLPGIGKVEAYSAEYALRVWFNPDQLNAYGLTTADVEAAIRARN
00392481   1/2  ----------------------------------------------------------------------
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00474561   1/1  ----------------------------------------------------------------------
00474571   1/1  laltsdgldllelrdyadlvlrdeLlrvpgVgevqlfGgqe.............................
00474591   1/1  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------pqlrveldpdklaalgltlsdvanalqaan
00392472   2/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------pqlrveldrdklaalglslsdvasalqaan
00474581   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GSVTPGQLGGAPSKPGQSYQAVVRPPAPLADPEAFGRIVLRSAADGSAVLLRDVARVEMAAADYRYSSTL
00392481   1/2  ----------------------------------------------------------------------
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392491   1/2  ---------------------------------------------------------idlvlgpslisre
00474561   1/1  ----------------------------------------------------------------------
00474571   1/1  ..............................................................dyrllarl
00474591   1/1  ----------------------------------------------------------------------
00392461   1/2  vqvlggllvgtfllggreyevvvradglrlspedlenlvvrtnadgslvpLsdvAtvelgvg--------
00392472   2/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392471   1/2  ggvpvgtlle....ggreylvrvqadpglrlspedlenlvvr.tadgalvpLsdvAtvelgv--------
00474581   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           NGREAASMGLKLADGANVLATSRTVRDALDEAAKAFPAGVAYDISYDTAHFVQSSISRVLMTLAEATVLV
00392481   1/2  --------------gantgevvdavrallee...alpagvtvevtgvsadlieeaisdlllalllalllv
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392491   1/2  ngkravlvrvnlrggdltse..eavalalallagalpagvsvevggdleeq..........alllallli
00474561   1/1  ----------------------------------------------------------------------
00474571   1/1  ngkpavglavllqpganalevaeavkalleelekslPegvelvivyDrt---------------------
00474591   1/1  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           FLILYLFLGNLRATLIPCIVVPVSLLGTVACLYAFGLSLNVITLFGVVLAIGILVDDAIVVVENVERIMR
00392481   1/2  flvlllflrslraalivllalplsllgalgllallgislnllslvglilliGlgvddaivlverireelr
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392491   1/2  fllllllfrslrlallallalplaligalgllallgiplsllslaglilliGiavddsillvdrireell
00474561   1/1  ----------------------------------------------------------------------
00474571   1/1  ----------------------------------------------------------------------
00474591   1/1  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           EEGVDAFTAASRSMREVSGALLAVTLVLCAVFVPMAFLGSAVGVIYRHFAMTLAISIAFSLFFALSLAPA
00392481   1/2  eeglslreailealrergrpilltalttilgflplafsggaggpllrpfaltlalglllstllaltllPa
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392491   1/2  regldlreaiiealrrrlrpilltalttllgflplllstglgspflrgfalalaigllvstlltlfllPa
00474561   1/1  ----------------------------------------------------------------------
00474571   1/1  ----------------------------------------------------------------------
00474591   1/1  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           MCASLLRHGAQPARGPLAWFEHRFTAFTTRYAGWVQRLQQRRLRWLAVYLAMAAVCAVGLWQLPSGFLPE
00392481   1/2  llallgr---------------------------------------------------------------
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392491   1/2  llallgrrrekk----------------------------------------------------------
00474561   1/1  ----------------------------------------------------------------------
00474571   1/1  ----------------------------------------------------------------------
00474591   1/1  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           EDTGELVIDVELPPGSTQAQTRETIAQLEQWMKQERLPVKTSFALLGWNSGGSGEQRASVFLSLDDWKLR
00392481   1/2  ----------------------------------------------------------------------
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00474561   1/1  ----------------------------------------------------------------------
00474571   1/1  ----------------------------------------------------------------------
00474591   1/1  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00474581   1/1  EDqgyllvlvqlPegaslerteavldeveeillelelpevesvfsvaGfsflgggsnagllfvtLkdwde


                         -         +         -         -         -         -         *:700
query           GRENAADVVLARLTKGLEEWPGRGDAQLYPYNGTALPELGSTSGLDMRLVTRLEGGRPSLYAARDKLIER
00392481   1/2  ----------------------------------------------------------------------
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00474561   1/1  ----------------------------------------------------------------------
00474571   1/1  ----------------------------------------------------------------------
00474591   1/1  --------------------------------------lGtsgGfelqlvdrgglgleaLleaanellaa
00392461   1/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00474581   1/1  Rkrkelsaaaiiarlrkklagi------------------------------------------------


                         -         -         -         -         +         -         -:770
query           AKADPVFAEVRATAGQPVPALDLAIDYRKAESFGVDTEAIHHALAATLGSRYIDELARDGRVRRVILQAD
00392481   1/2  ----------------------------------------------------------------------
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00474561   1/1  ----------------------------------------------------------------------
00474571   1/1  ----------------------------------------------------------------------
00474591   1/1  ankspelagvrsdlkadv....................................................
00392461   1/2  ----------------------------------------------------------------------
00392472   2/2  ------------------pqlrveldrdklaalglslsdvasalqaanggvpvgtlleggreylvrvqad
00392462   2/2  ------------------pqlrveldpdklaalgltlsdvanalqaanvqvlggllvgtfllggreyevv
00392471   1/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           APFRMQPEDLARLHVRNAQGQMVSLGAFATLEWGNGEATLERYNGLISVRINADVAPGTSTGTAMTRLES
00392481   1/2  ----------------------------------------------------------------------
00392492   2/2  ------------------------------idlvlgpslisrengkravlvrvnlrggdltseeavalal
00392482   2/2  ---------------------------------------------------------gantgevvdavra
00392491   1/2  ----------------------------------------------------------------------
00474561   1/1  ----------------------------------------------------------------------
00474571   1/1  ----------------------------------------------------------------------
00474591   1/1  ..................................vgppllnrynllpsatisgslapGvssGeAlaalee
00392461   1/2  ----------------------------------------------------------------------
00392472   2/2  pglrlspedlenlvvrtadgalvpLsdvAtvelgvg----------------------------------
00392462   2/2  vrad.glrlspedlenlvvrtnadgslvpLsdvAtv----------------------------------
00392471   1/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           LVRELGPDYEVRWSGRAFEQQQSGTQAPWLFALSMLFIFLCLVALYESWTLPLAVLAIVPAGLVGAASAV
00392481   1/2  ----------------------------------------------------------------------
00392492   2/2  allagalpagvsvevggdleeq.........alllalllifllllllfrslrlallallalplaligalg
00392482   2/2  lleealpagvtvevtgvsadlieeaisdlllalllalllvflvlllflrslraalivllalplsllgalg
00392491   1/2  ----------------------------------------------------------------------
00474561   1/1  ----------------------------------------------------------------------
00474571   1/1  ----------------------------------------------------------------------
00474591   1/1  laaelPagygyeW---------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           WLRGLPNDVYFKVGVIVIMGLAAKNAILVVEYAEQLRRNGLERVQAATQAARQRLRPVVMTSLAFILGVV
00392481   1/2  ----------------------------------------------------------------------
00392492   2/2  llallgiplsllslaglilliGiavddsillvdrireellregldlreaiiealrrrlrpilltalttll
00392482   2/2  llallgislnllslvglilliGlgvddaivlverireelreeglslreailealrergrpilltalttil
00392491   1/2  ----------------------------------------------------------------------
00474561   1/1  ----------------------------------------------------------------------
00474571   1/1  ----------------------------------------------------------------------
00474591   1/1  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           PLAISTGPGAGAQRAVGTGVLGGMLGATILGTLVIPLLYAWIARWSKARATTEPAKAPASEPGA------
00392481   1/2  ----------------------------------------------------------------------
00392492   2/2  gflplllstglgspflrgfalalaigllvstlltlfllPallallgrrr---------------------
00392482   2/2  gflplafsggaggpllrpfaltlalglllstllaltllPallal--------------------------
00392491   1/2  ----------------------------------------------------------------------
00474561   1/1  ----------------------------------------------------------------------
00474571   1/1  ----------------------------------------------------------------------
00474591   1/1  ----------------------------------------------------------------------
00392461   1/2  ----------------------------------------------------------------------
00392472   2/2  ----------------------------------------------------------------------
00392462   2/2  ----------------------------------------------------------------------
00392471   1/2  ----------------------------------------------------------------------
00474581   1/1  ----------------------------------------------------------------------