[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF08055.1


[Show Plain Result]

## Summary of Sequence Search
   1::243
  17::226  4.1e-64 41.8% 0046766 00467661 1/1   de methionine sulfoxide reductase       
  53::225  7.7e-63 53.0% 0048456 00484561 1/1   de methionine sulfoxide reductase       
  22::212  3.6e-59 43.2% 0046864 00468641 1/1   de methionine sulfoxide reductase       
   1::243


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDAMTTLQRWTRPTALKLASLAVLMVAAAMWELPAISAEAAVKIPAPAVDEKAGTSHTETAVFAGGCFWG
00467661   1/1  ----------------lllrkllllllleallgllllllllllllvlgllllllpegletavlagGCfWg
00484561   1/1  ----------------------------------------------------lllegletavlagGCfWg
00468641   1/1  ---------------------ellllllalllllllllllllllvlllllllllpegletavlagGCfWg


                         -         -         *         -         -         -         -:140
query           VQGVFQHVRGVTRVTSGYSGGSASNAQYEMVGTGMTGHAESVEIRYDPTQISYGKLLQIFFSVAHNPTQL
00467661   1/1  veavfeklpGVlsvvvGYagGttenPtYeevcsgltghaEavrvvydpevvsyeeLlevffei.hdPtql
00484561   1/1  veavfeklpGvlsvesGyagGttenPtyeevc....ghaeavevtydpevisyeeLlelffei.hdPtql
00468641   1/1  veavfeklpGVlstevGYagGltenPtYeevcsgltghaEavrvvydpevisyeeLlevffei.hdPtql


                         +         -         -         -         -         *         -:210
query           NYQGPDHGTQYRSAIFPRSPVQRSIAEAYITQLDTSKAYRAPIVTRVEDYKGFFPAENYHQDFLVKNPSY
00467661   1/1  nrqgndvGtqYrsaifyldeeqlelaeasieelqkeleaglfgkpivteilplsnFypaedyhqdYlakn
00484561   1/1  nrqgndvgtqYrsaifyldeeqlelaeasieelqksllfdkpivteilplsnfypaeeyhqdylkknplg
00468641   1/1  nrqgndvGtqYrsaiyyldeeqlelaeasleelqkelegllgkpivteilplsnfypaeeyhqdYlaknp


                         -         -         -         +         -         -         -:280
query           PYIVINDLPKIGNLKTMFPDVYRNDAVLVSKGG-------------------------------------
00467661   1/1  pl.gYcllvitpkllk------------------------------------------------------
00484561   1/1  yylllvilpklellk-------------------------------------------------------
00468641   1/1  lg--------------------------------------------------------------------