[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF08099.1


[Show Plain Result]

## Summary of Sequence Search
   1::358
  18::358   3e-104 39.2% 0050003 00500031 1/1   inked oxidoreductases                   
  18::358  7.9e-84 38.3% 0049708 00497081 1/1   inked oxidoreductases                   
  61::358  2.5e-77 37.4% 0036258 00362581 1/1   inked oxidoreductases                   
  18::356  4.8e-77 32.1% 0046721 00467211 1/1   inked oxidoreductases                   
  62::358  6.9e-71 33.7% 0047140 00471401 1/1   inked oxidoreductases                   
  61::358  4.2e-64 33.3% 0051899 00518991 1/1   inked oxidoreductases                   
  61::350  1.1e-61 33.0% 0046599 00465991 1/1   inked oxidoreductases                   
  63::358  4.7e-59 35.5% 0052481 00524811 1/1   inked oxidoreductases                   
  60::358  9.2e-47 22.8% 0048029 00480291 1/1   inked oxidoreductases                   
  55::357    2e-28 26.2% 0050135 00501351 1/1   inked oxidoreductases                   
 119::357  2.1e-25 27.2% 0039992 00399921 1/1   ose-phoshate binding barrel             
  64::358  1.7e-20 21.6% 0049587 00495871 1/1   inked oxidoreductases                   
  65::358  2.8e-17 20.9% 0047026 00470261 1/1   inked oxidoreductases                   
 186::343  8.6e-17 34.1% 0041152 00411521 1/1   ase                                     
 186::341  1.1e-16 28.5% 0049848 00498481 1/1   ase                                     
  73::356    3e-14 24.4% 0044760 00447601 1/1   inked oxidoreductases                   
 234::359    2e-10 29.5% 0049629 00496291 1/1   ose-phoshate binding barrel             
 173::354  2.4e-09 26.1% 0052610 00526101 1/1   inked oxidoreductases                   
 238::354  1.2e-08 22.7% 0045712 00457121 1/1   ose-phoshate binding barrel             
  66::360  6.1e-08 19.4% 0045046 00450461 1/1   in phosphate synthase                   
 162::343  9.2e-08 27.2% 0051598 00515981 1/1   ose-phoshate binding barrel             
 232::343  2.2e-07 29.2% 0047996 00479961 1/1   inked oxidoreductases                   
 240::335  2.2e-07 30.7% 0041658 00416581 1/1   ase                                     
 232::344  2.3e-07 27.3% 0047242 00472421 1/1   inked oxidoreductases                   
 288::357  9.6e-07 31.9% 0051442 00514421 1/1   ose-phoshate binding barrel             
 208::344  4.8e-06 26.5% 0039781 00397811 1/1   ose-phoshate binding barrel             
 298::357  5.9e-06 33.3% 0048998 00489981 1/1   ose-phoshate binding barrel             
 232::343  8.2e-06 26.0% 0046501 00465011 1/1   inked oxidoreductases                   
 216::343    9e-06 25.4% 0050717 00507171 1/1   like                                    
  56::343  9.1e-06 18.3% 0047561 00475611 1/1   ne monophosphate dehydrogenase (IMPDH)  
 297::359  1.3e-05 35.6% 0050201 00502011 1/1   inked oxidoreductases                   
 282::359  3.7e-05 30.7% 0046530 00465301 1/1   ne monophosphate dehydrogenase (IMPDH)  
 279::357    5e-05 31.9% 0050322 00503221 1/1   ose-phoshate binding barrel             
  56::359  7.7e-05 22.3% 0042445 00424451 1/1   inked oxidoreductases                   
 168::357  0.00013 24.1% 0051489 00514891 1/1   inked oxidoreductases                   
 288::360  0.00022 25.0% 0048294 00482941 1/1   ase                                     
 294::359  0.00022 28.6% 0047125 00471251 1/1   ose-phoshate binding barrel             
 294::343  0.00036 31.2% 0049739 00497391 1/1   like                                    
 288::337  0.00047 36.0% 0048832 00488321 1/1   ne monophosphate dehydrogenase (IMPDH)  
 232::354  0.00066 29.0% 0038429 00384291 1/1   inked oxidoreductases                   
 285::358  0.00095 26.4% 0049146 00491461 1/1   ose-phoshate binding barrel             
   1::358


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVPTPRRPWPRPTLVLNALYPLLRPALFSMDAEDAHHFTLNNLMRAKRMGLAGCIGNSIADDPRTVMGVR
00500031   1/1  -----------------lyklllrpllflldpelahrlnlaalklllllp...lldvddpdlstellGlk
00497081   1/1  -----------------lnlldlralalrrllrpllfyldgetahrltlaflrigllprvlv...vsdvd
00362581   1/1  ------------------------------------------------------------merlaelmlp
00467211   1/1  -----------------alrrllrpllfylddevtlrlnllafddilllprvlpdvsldvdlsttllglt
00471401   1/1  -------------------------------------------------------------Lstellglt
00518991   1/1  ------------------------------------------------------------Dlstellglk
00465991   1/1  ------------------------------------------------------------pkdvpllstl
00524811   1/1  --------------------------------------------------------------lLsttllg
00480291   1/1  -----------------------------------------------------------delllllglrl
00501351   1/1  ------------------------------------------------------rnllafddvllvprvl
00399921   1/1  ----------------------------------------------------------------------
00495871   1/1  ---------------------------------------------------------------nllslad
00470261   1/1  ----------------------------------------------------------------esllnl
00411521   1/1  ----------------------------------------------------------------------
00498481   1/1  ----------------------------------------------------------------------
00447601   1/1  ----------------------------------------------------------------------
00496291   1/1  ----------------------------------------------------------------------
00526101   1/1  ----------------------------------------------------------------------
00457121   1/1  ----------------------------------------------------------------------
00450461   1/1  -----------------------------------------------------------------iimll
00515981   1/1  ----------------------------------------------------------------------
00479961   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00472421   1/1  ----------------------------------------------------------------------
00514421   1/1  ----------------------------------------------------------------------
00397811   1/1  ----------------------------------------------------------------------
00489981   1/1  ----------------------------------------------------------------------
00465011   1/1  ----------------------------------------------------------------------
00507171   1/1  ----------------------------------------------------------------------
00475611   1/1  -------------------------------------------------------lvfdYldggagdelt
00502011   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00503221   1/1  ----------------------------------------------------------------------
00424451   1/1  -------------------------------------------------------kmsrLfeplklgglt
00514891   1/1  ----------------------------------------------------------------------
00482941   1/1  ----------------------------------------------------------------------
00471251   1/1  ----------------------------------------------------------------------
00497391   1/1  ----------------------------------------------------------------------
00488321   1/1  ----------------------------------------------------------------------
00384291   1/1  ----------------------------------------------------------------------
00491461   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FPNPVGLAAGLDKDGAYIDGLAAFGFGFIEVGTVTPRAQPGNPRPRMFRLPQADALINRMGFNNGGVDAF
00500031   1/1  lknPiglAagpdknaealdalldlgfGavelgtvtpdpqagnptprlarlaedagginrlglnnlgldav
00497081   1/1  lstellglklknPfglapmgdknlelaralaalgaglvvtgtvtpvpqegnpkprlfrlpedealinlyg
00362581   1/1  krlipyllvgldrevthrlnlkaldrvalipevtagdpdlsttilglelknPlvlapmaggnaelaaala
00467211   1/1  lknPlvlapmtvtdaelaialaalgaglivlgtvtveplegnvsprllrlpedeaiinlyglndpgleel
00471401   1/1  lknPlvlApmadvtdlelrraaarggaglvvtemvtaeqpqegnpkprlfrlpedevllvaevlglinrm
00518991   1/1  lknPiglApmgvskdaeaiaalaagglGiielgtvtlapqegvtdprvrrlgag..linleglnnrglea
00465991   1/1  ilglklknPiilApmadvtdaelaaalalaggggvlgktmtpepqagnpvprarrl..deaginrlgfnd
00524811   1/1  lklknPlglaaglvdkdaeailalaalgfgiielgtvtlapmagvtdprlrrl..gagllnreglnndgl
00480291   1/1  lyllelllpelrqylsladleelafrrlprslfdyldggaddeltlgrnlaafddvllrprvlvdvddvd
00501351   1/1  pevdvsdvdlsttllgltlknPliiapm.....................gggtlsapagn..palaraaa
00399921   1/1  ------------------------------------------------mlakriipaldlkdgrvvrliv
00495871   1/1  lealakrrlpkrkfdyldggagdevtlrenrlafddvllvprvlpdvsdvdlsttllgiklslPliiap.
00470261   1/1  adlealarrrlpkrkfdyldggagdevtlrrnrlafddvllvprvlpdvsdvdlsttllglklslPliia
00411521   1/1  ----------------------------------------------------------------------
00498481   1/1  ----------------------------------------------------------------------
00447601   1/1  --nrlvlAPMvgvtdlpfrlllarlgaglvytemvtakdllrgglkrl..llavdeegrplvvqlagsd.
00496291   1/1  ----------------------------------------------------------------------
00526101   1/1  ----------------------------------------------------------------------
00457121   1/1  ----------------------------------------------------------------------
00450461   1/1  kriylildvdiedllelaeaaleaGadaiqlrvkdp.....spegllelaeaikelakkv.....dvpli
00515981   1/1  ----------------------------------------------------------------------
00479961   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00472421   1/1  ----------------------------------------------------------------------
00514421   1/1  ----------------------------------------------------------------------
00397811   1/1  ----------------------------------------------------------------------
00489981   1/1  ----------------------------------------------------------------------
00465011   1/1  ----------------------------------------------------------------------
00507171   1/1  ----------------------------------------------------------------------
00475611   1/1  lrrnrlafddvllvPrvltvldvsevdlstlllglglkiPiiiapmagv....sepalaiaaakaGglgv
00502011   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00503221   1/1  ----------------------------------------------------------------------
00424451   1/1  lknRivmaPmtryladdgvptdlllayyaqrakggagliiteatavs.............pegrgypgtl
00514891   1/1  ----------------------------------------------------------------------
00482941   1/1  ----------------------------------------------------------------------
00471251   1/1  ----------------------------------------------------------------------
00497391   1/1  ----------------------------------------------------------------------
00488321   1/1  ----------------------------------------------------------------------
00384291   1/1  ----------------------------------------------------------------------
00491461   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           IRNVQASRWKAEGGVLGLNIGKNADTPIERAADDYLYCLERVYPHASYVTVNISSPNTKNLRQLQGASEL
00500031   1/1  leelrelrkelvrelapdiplivnlggnklt..edavedyvelarrleegadalelnvssPntpglrelq
00497081   1/1  lnnegldallerlkalkallllllleaggplivqiggsglfgsrp..edlaeaaellepladaielnlsc
00362581   1/1  agGagaievgtvtpdpqagnpvprlarlralagginrmglnnlgldalleelravrlavvkraapdvpvg
00467211   1/1  lervkaagiki...pvganlgvdeilplgarvedfaeaarlaeegadaielnfssPnlpnlrsdeyggsl
00471401   1/1  glnnlglealleeiralkdaagdlpvivqlgvgsd......pedlaeaarraeeaGadaielnlgcPntk
00518991   1/1  lllelakaa.gikglplgvniggs...gpeelaeaakllvrlleagadaielnigcpntgggaallldpe
00465991   1/1  lgaaaelrrllkll...vksiaevpiivnlvgggirel.daedarllleagadavelnigcpntpvlgal
00524811   1/1  eaalkllrralkagkpglpvgvnlggnr.......pedlaeaarlleeagadailelnlgcpntlggsal
00480291   1/1  lsttilglklknPlvlapmgfgglsepieaeialaraaaelgggipiilgemgnvslerlaaavsgaggl
00501351   1/1  raGglgvigsgglgsleelaeairrvrdlapggplgvnlggaq..daepgveeaaraaeeag..adalel
00399921   1/1  glnggdpedpveaakaae...eaGadaielndldpallgp..ealleviraireavgipvivgggirspe
00495871   1/1  ....................mggvtllspdge..palaraaaraGglgvlgsgslgleeevrkakp....
00470261   1/1  pmagvtllhpdgeaalaraaaraGglgv.lgsgslapee.....evrkaapgpfgvnlyglk...dpell
00411521   1/1  ---------------------------------------------adeieinishgnl.......legdl
00498481   1/1  ---------------------------------------------adeidlvincgalkag.......dp
00447601   1/1  ................................pedlaeaaklaeegadgidlnfgcpvskvrrdgyGaal
00496291   1/1  ----------------------------------------------------------------------
00526101   1/1  --------------------------------lkkglivaltlgdpdkedlvelakaleeaGadaieldg
00457121   1/1  ----------------------------------------------------------------------
00450461   1/1  vndg..velaleagadgvhlgg..........pdllleaarelglgvivgvsvhtleealeaeelgadyi
00515981   1/1  ---------------------qgggidpedpaelaraaeea...Gadaielndgcpf..dsrlldgs.gl
00479961   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00472421   1/1  ----------------------------------------------------------------------
00514421   1/1  ----------------------------------------------------------------------
00397811   1/1  -------------------------------------------------------------------aal
00489981   1/1  ----------------------------------------------------------------------
00465011   1/1  ----------------------------------------------------------------------
00507171   1/1  ----------------------------------------------------------------------
00475611   1/1  lgaggstpeealaealvkralt................llplavklglgalpvaaavgagtavllraaal
00502011   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00503221   1/1  ----------------------------------------------------------------------
00424451   1/1  glwsdeqieglkkl.tdavhaeggkifiqLahagrvasgllpvapsaipaplglvvpraltleeieeiie
00514891   1/1  ---------------------------igeiiedfaeaAkraieaGfdgvelhgahgyLldqFlspltnv
00482941   1/1  ----------------------------------------------------------------------
00471251   1/1  ----------------------------------------------------------------------
00497391   1/1  ----------------------------------------------------------------------
00488321   1/1  ----------------------------------------------------------------------
00384291   1/1  ----------------------------------------------------------------------
00491461   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DSLLSTLKAAQQRLADQHKRYVPVALKIAPDLDDDQVRNIGDALVRHKIDGVIATNTTISRDAVKGLPHA
00500031   1/1  lglalgllpelllevveavkkavg..lpvivKlapdlteediaeiaraaeeagadgiivtNttggrlldl
00497081   1/1  PakpglggllgaalledfiaaarraveagadiielgiasgylldgfliplanlraleyGndpelllelik
00362581   1/1  vnlggnk..paefgvddyelarraleaGadaivlnvsapnlpglrkdqgggallpdpelvlelikalkea
00467211   1/1  enrprllleiikavreavgedvpvivKlspgldvediedlakaleeaGadaiivsngigggtgltplela
00471401   1/1  vlrgggaallqdpellleivkavreavg.........ipvivKlrpggd..dtvelaraaeeaGadgiiv
00518991   1/1  lllelikalreav.........gipvivKirpgidtaedveiakaleeaGladaiivsnrtggtlaadig
00465991   1/1  lakd.......pelvaivvaavkkavkvpvvvkivpgvdd..lveiakaleeaGadaiivtnttagghlg
00524811   1/1  lkdpelllelleavkeavd.........vpvivKispgvgiediediakalveaGadaivvsntthggrq
00480291   1/1  gsfglyalgdlevleellrrakaagikpigvnlgkpgeggalaaikvseagadaidlnlgaplvdpvvdv
00501351   1/1  nvdlpql.gsreldrprlllellealreavg.........vpvivKlvggvltv...edaralleaGada
00399921   1/1  daralleaGadavivgsalledpellaellealgpevivvaidvkavgvpvtvkirggldltdvdavela
00495871   1/1  ..dgplivnlyaskdrgvlaelleraeeag.....adaivltvdspllgqrardlrggfllglkvtaeil
00470261   1/1  aellrraeaagadaivltvglpvlgvrerdlrlgfllppaaggalladlaralalvlagadelvlvvsdg
00411521   1/1  elllelikaikeavg...gvvvkvilgtvll.deeeivelaealieaGaDgi..................
00498481   1/1  elvlelikavreavg.....gvpvkviletglltveeiveaaraaveaGadfiktst.............
00447601   1/1  lkdpelvleivkavreavp......ipvtvkirlgwdledtvelakaleeaGadaltvhg..........
00496291   1/1  -----------------------vatrggleltgvdlvelakaaeeaGadailvtsi.............
00526101   1/1  sf..................gvtvenvlelvkavkevdvpvvlkgginpilrigvdgvlipdlpveepee
00457121   1/1  ---------------------------gaaalsdpelvellelakelglevlvevht......leeakra
00450461   1/1  ..................................................................llgp
00515981   1/1  lpdpeiikavrkav......svpvivkgrigsdedvelalaagadgvtvgtlagedpeelleaakelglp
00479961   1/1  ---------------------vpvivKlvagvgigt...dAaaaaeaGaDaivvsGheGGTGaaplrsld
00416581   1/1  -----------------------------gdldleeiveaakaaaeaGadfi.................k
00472421   1/1  ---------------------vpvivkgvatved......arraleaGadaivvsghggggl........
00514421   1/1  ----------------------------------------------------------------------
00397811   1/1  lddpelveaiveavkeavpvpvtvkirggtelgdidavelakaleeaGadailvtgr.............
00489981   1/1  ----------------------------------------------------------------------
00465011   1/1  ---------------------vpvivKlvggvgt...vedAalaakaGaDaivvsGheGGTgaaplrsld
00507171   1/1  -----dllviggktflsrlllGtgkydspellqeaiaesgaeivtvalrrvnlggdgaldllldllkegg
00475611   1/1  leagvd....................vividvapgsdpsllwdllaikrl....kpkgpvvvkgvatved
00502011   1/1  ----------------------------------------------------------------------
00465301   1/1  ----------------------------------------------------------------------
00503221   1/1  --------------------------------------------------------------------tg
00424451   1/1  dfaeaarraleaGfdgveihgahgyLldqFlsplsnvrtdeyGgs.lenrprlllevveavreavgadfi
00514891   1/1  rtdeyGgslenrarfllevveavreavg...fpvgvrlspldlvegglnleeavelakaleeagvdllhv
00482941   1/1  ----------------------------------------------------------------------
00471251   1/1  ----------------------------------------------------------------------
00497391   1/1  ----------------------------------------------------------------------
00488321   1/1  ----------------------------------------------------------------------
00384291   1/1  ---------------------fpvgvrlspldlvggmarlgltledavelakaleeaGadylhvsdgdga
00491461   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           EEAGGLSGRPVFEASTRVVRALREVIGDALPIIGVGGIFSGADARAKIDAGAQLVQVYSGLIYRGPTLVR
00500031   1/1  epllgveagglsgaalkplalrlvaevreavggdipiigvGGIrtgedalealaaGAsaVqvgtallyeg
00497081   1/1  alreavg..vPlvivKirpglsvedieeiakaleeaGadgiivsnttagghgrtslegv..tgglsglpl
00362581   1/1  vg..lpvivklapgltgvdtvelakraeeaGadavvvsnttggrgldgttrrvaeagglsGaplkpasle
00467211   1/1  gvhgglsglplapaslevlaelreavggripviadGGirsgedaakalalGAdaVmigrallyagpdlvr
00471401   1/1  hnrtgtqlidvearkallglglgsinetgglsgpaippaaleliaevreavp.gipvianGGIrtgedal
00518991   1/1  pgsllttrlvehgglsgdalpplalellaevaeavgd.ipviadGGIrsgedaakalalGAdaVmiGraf
00465991   1/1  lellkpilkvgigglsgrplrplalelvpqlakav..diPviasGGIrsgedaaealaaGAdaVqvGtaf
00524811   1/1  ldiegvdlivaqgp..eagglsGnalapaaleliaeiadavkgdipviadGGIrsgedaakalalGAdaV
00480291   1/1  gsistlggdpel...........vledlkalreavg..vpvivKlvptved......AkaaeeaGaDaiv
00501351   1/1  ivvsgggggghidvetlravgaattggllgvgv..ptlallaevrealg.dipviadGGirtgedaakal
00399921   1/1  kaleeagadailvt..................gglgggtlggadlelvaeiaeavg..iPviasGGirsp
00495871   1/1  alrlvppgealispahgdpilsledlkalrealg..vpvivkgvltved......allaaeaGadaivvs
00470261   1/1  dpeg................lleliealreatg..vpvivkgvatved......araaaeaGadaivvsg
00411521   1/1  kvsgGfggi...gatlealrliaevvkekipiiadGGIrsgedalkalaaGAdlvgvgsalai-------
00498481   1/1  ....gggsg....gatlevlaliveavggkipviaaGGirtaedalkalaaGAdavgvgsa---------
00447601   1/1  .......rtrsqrytgpadleaikevke....sipvianGgirtpedaakaleatGadgVmigraal.gn
00496291   1/1  drdgtlsgp.....dlellkevaeavs..ipviasGGigsledaaellaaGadavlvGsal.lggplllk
00526101   1/1  faeaaaeagadiivlhapttgdlrlikeaggfayvvlnpgtsvagvtgarpvlglvdlvlaaavaeglsg
00457121   1/1  lelgadligvnnrdgttggvdlellkelaeavpkdipviasGGisspediaelleaGadgvlvGsal.mk
00450461   1/1  vfptgtkpgf.gplglellrelveav..kipviasGGi.tpenaaealeaGadgvavgsailgap..dpa
00515981   1/1  vivgardakealraarlgrealrtkgikllpdvvttveaaraaeeaGadvigvtg........-------
00479961   1/1  g.............aGlptilalaevadalvenglrdripviadGGirtgrdvakalalGAda-------
00416581   1/1  tstGfggg....gatlealrlilevvkdkipviaaGGIrtgeDalkalaaGadri---------------
00472421   1/1  .....dvgiptlaalpevveav......dvpviadGGirtggdvakalalGAdaVlvGtaflya------
00514421   1/1  -------tgtvagvgppdlellrevvevgipviadGGIrtpedaakalaaGAdgvlvGsallg.apeppg
00397811   1/1  trdgtlsg.....adlelirevkeav..kiPViasGGigtpedaaaaleelGadgvlvgsallg------
00489981   1/1  -----------------llkklaeavs..ipviasGGigsledlkellelsnlletgadgvlvgsal.lg
00465011   1/1  g.............aglptllalaevadalvenglrdripviadGGirtgrdvakalalGAda-------
00507171   1/1  vallpntagartaveavriavlareiglgtdavklevigddlillpdvletleaaealvkagf-------
00475611   1/1  ......AkkaeeaGaDaivvsgg..............gggghtgrlstgvllpqivavrlvae-------
00502011   1/1  ----------------ellkalreavg..ipvviagGGistpedaaelle.gAdgvvvGsa.ifkgedpl
00465301   1/1  -gGggltgrevlgvgvptltalpevadavk...grdipviadGGIrtggdvakalalGAdaVmiGtaflg
00503221   1/1  idrdgtlggp....dlellrevaeavd..ipviasGGigsledlaaalellalGadgvlvGsal.lggpe
00424451   1/1  vgvRlspddlvgggltleeavelakaleeaGadyihvs.................ggtleglvplestpv
00514891   1/1  shg..............rtsglstpaipgafldlaaavkkavs..ipviavggitspedaeealeeggad
00482941   1/1  -------GfllggatledvllmleavggldvgvkaaGGirtledalkllaaGad.........riGtssl
00471251   1/1  -------------pdlellkevaeavs..ipviasGGigtpedaaklleaGadgvivGsa.lfggplile
00497391   1/1  -------------adlellrevaeav..diPviadGGIgtpedaakalelGAdgVlvGsaiag-------
00488321   1/1  -------gvpqltalpevadavreyleegglgipviadGGirdggdiakalalGAda-------------
00384291   1/1  .................g..geganlelieaireavg..ipviasGgi.tpedaeealaagladlValGr
00491461   1/1  ----GvtGqktgfipevlelvkevkkat..dipvivggGIstpedakealeaGAdgvvvGsaivkaidga


                         -         -         -         -         *         -         -:420
query           ECASALRR--------------------------------------------------------------
00500031   1/1  palvkeil--------------------------------------------------------------
00497081   1/1  lpasleli--------------------------------------------------------------
00362581   1/1  llreiaea--------------------------------------------------------------
00467211   1/1  kilegl----------------------------------------------------------------
00471401   1/1  ealaaGAd--------------------------------------------------------------
00518991   1/1  lyggpall--------------------------------------------------------------
00465991   1/1  ----------------------------------------------------------------------
00524811   1/1  miGrafly--------------------------------------------------------------
00480291   1/1  vsga....--------------------------------------------------------------
00501351   1/1  alGAdaV---------------------------------------------------------------
00399921   1/1  edaakal---------------------------------------------------------------
00495871   1/1  gh......--------------------------------------------------------------
00470261   1/1  ........--------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00498481   1/1  ----------------------------------------------------------------------
00447601   1/1  pelfge----------------------------------------------------------------
00496291   1/1  eikelleel-------------------------------------------------------------
00526101   1/1  llii------------------------------------------------------------------
00457121   1/1  apdp------------------------------------------------------------------
00450461   1/1  eaakalleav------------------------------------------------------------
00515981   1/1  ----------------------------------------------------------------------
00479961   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00472421   1/1  ----------------------------------------------------------------------
00514421   1/1  eakelle---------------------------------------------------------------
00397811   1/1  ----------------------------------------------------------------------
00489981   1/1  gpltlee---------------------------------------------------------------
00465011   1/1  ----------------------------------------------------------------------
00507171   1/1  ----------------------------------------------------------------------
00475611   1/1  ----------------------------------------------------------------------
00502011   1/1  keaieflka-------------------------------------------------------------
00465301   1/1  tleapgeev-------------------------------------------------------------
00503221   1/1  slaeake---------------------------------------------------------------
00424451   1/1  pggadlela-------------------------------------------------------------
00514891   1/1  lvalgRa---------------------------------------------------------------
00482941   1/1  leilaelekg------------------------------------------------------------
00471251   1/1  eakalleel-------------------------------------------------------------
00497391   1/1  ----------------------------------------------------------------------
00488321   1/1  ----------------------------------------------------------------------
00384291   1/1  all.------------------------------------------------------------------
00491461   1/1  laieelle--------------------------------------------------------------