[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF08451.1


[Show Plain Result]

## Summary of Sequence Search
   1::139
  17::130  1.4e-26 33.0% 0046377 00463771 1/1   ike sensor domain (PAS domain)          
   9::124    9e-25 31.9% 0040536 00405361 1/1   ike sensor domain (PAS domain)          
  10::119  2.6e-24 35.6% 0048644 00486441 1/1   ike sensor domain (PAS domain)          
   9::120  3.8e-23 33.6% 0050109 00501091 1/1   ike sensor domain (PAS domain)          
   4::118  5.9e-23 32.1% 0048248 00482481 1/1   ike sensor domain (PAS domain)          
  11::122  1.1e-22 33.3% 0041279 00412791 1/1   ike sensor domain (PAS domain)          
   4::122  1.7e-22 35.0% 0037219 00372191 1/1   ike sensor domain (PAS domain)          
  14::121    4e-22 35.6% 0046903 00469031 1/1   ike sensor domain (PAS domain)          
   4::119  1.2e-21 36.4% 0048459 00484591 1/1   ike sensor domain (PAS domain)          
  13::124  3.7e-21 30.6% 0046045 00460451 1/1   ike sensor domain (PAS domain)          
  11::126    8e-21 34.8% 0048715 00487151 1/1   ike sensor domain (PAS domain)          
  15::123  3.9e-18 30.5% 0048579 00485791 1/1   ike sensor domain (PAS domain)          
   1::139


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTISTNTAAQILEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAA
00463771   1/1  ----------------DgiivldldgrilyvNpaaerllGysaeellgknlldlippedrerllaalrra
00405361   1/1  --------rllleaapdgilvldldtgrilyvNdaaerllGyspeellGkslldllhpedreavlealer
00486441   1/1  ---------allenapdgiivlDadgrilyvNpaaeellGyspeeviGknlfdllippedreevlealre
00501091   1/1  --------arlralleaapdgiivldldgrilyvNpaaerllGyspeellGkplldllhpedrervleal
00482481   1/1  ---seerlralldaapdgiivlDadGrilyvNraaerllGyspeeviGrnlfsellppedrpafeaallr
00412791   1/1  ----------lleaapdgiwitdldgrilyvNpaferllGyspeellgknlrelvhpedrervlealrra
00372191   1/1  ---seerlrallesapdgiivldldgrilyvNpaaerllGyspeellGkslldllppedrervlealrra
00469031   1/1  -------------napdgiiitdldgrilyvNdaflellGysreellgknlrdlvhpedreavlaalwea
00484591   1/1  ---seerlralldslpdgiivlDadgrilyvNpaaeellGyspeeliGknlfellhpedlreavlealle
00460451   1/1  ------------eaapdgivitdldgrilyvNpaferllGysreellgkslllldllhpedrervlaalr
00487151   1/1  ----------lleaapdgifvldldgrilyvnpaflellGyspeellgkslldlihpedrervlealeea
00485791   1/1  --------------lddfifvldadGriiyvneaalrallGyspeeliGksiydfvhpedreesalreal


                         -         -         *         -         -         -         -:140
query           IDTGKTRLSGKPTLTKAIHKDGRKLFVEMTFALISDANGNVIGSVAVARDVTDKVERERAQSAAGPVSR-
00463771   1/1  laggeplllgvelelrlrrkdGslfwvelsisplrdegge..gvvgvlrDiTerkraeee----------
00405361   1/1  alaggevvtlllllelrlrrkdGsvrwvevsaspirdeggr.v..vgvvrDITe----------------
00486441   1/1  alagge......svelrlrrkdGslrwvevsaspirdedGevvgvvgvl---------------------
00501091   1/1  eralaggepvllgvegelrlrrkdGevrwvevsaspirdedg..vgvvgv--------------------
00482481   1/1  alatgep......lelrlrrkdGsrrwvlvtvsplrdedGevvgvvgv----------------------
00412791   1/1  lagg.epfsg...elrlrrkdGslrwvllsispirdedGevvgvvgiarDIT------------------
00372191   1/1  laggeplllgvslelrlrrkdGelrwvevsaspirdeggr..gvvgvvrDIT------------------
00469031   1/1  lrgg.epwsg...elrlrrkdGelrwvelsispirdedGevvgfvgvarDI-------------------
00484591   1/1  alatgepvrg....elrlrrkdGsrrwvsvs..pirdedGevvgvvgvf---------------------
00460451   1/1  ralaggepfsg....elrlrrkdGslfwvllsvspirdedGevvgvvgvvrDiT----------------
00487151   1/1  laggep....fsgeyrlrrkdGsyrwvevsaspirdeldgkvvgvvgvarDiTerK--------------
00485791   1/1  eevlakgev....rsfeyrflrkdGsyvwletsatpildpdtgklegvvgiar-----------------