[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF08536.1


[Show Plain Result]

## Summary of Sequence Search
   1::404
  35::395  7.9e-32 28.7% 0046834 00468341 1/1   AD(P)-binding domain                    
  43::398  2.1e-31 30.1% 0047712 00477121 1/1   AD(P)-binding domain                    
  43::379  3.5e-28 30.5% 0052926 00529261 1/1   AD(P)-binding domain                    
  35::341    1e-26 29.0% 0041341 00413411 1/1   AD(P)-binding domain                    
  35::267  1.2e-25 30.0% 0049222 00492221 1/1   AD(P)-binding domain                    
  40::341    3e-24 31.1% 0052032 00520321 1/1   AD(P)-binding domain                    
  35::287  5.7e-24 28.1% 0050363 00503631 1/1   AD(P)-binding domain                    
  35::340  9.1e-24 29.4% 0046446 00464461 1/1   AD(P)-binding domain                    
  35::342  4.7e-23 29.6% 0046270 00462701 1/1   AD(P)-binding domain                    
  35::342  8.6e-23 26.7% 0049003 00490031 1/1   AD(P)-binding domain                    
  43::388  1.2e-22 32.7% 0047022 00470221 1/1   AD(P)-binding domain                    
  41::342  1.4e-22 29.1% 0045797 00457971 1/1   AD(P)-binding domain                    
  35::342    3e-22 33.0% 0037441 00374411 1/1   AD(P)-binding domain                    
  43::341    4e-22 31.8% 0048494 00484941 1/1   AD(P)-binding domain                    
  35::352  1.3e-21 29.8% 0035989 00359891 1/1   AD(P)-binding domain                    
  35::342  4.2e-21 31.2% 0049150 00491501 1/1   AD(P)-binding domain                    
  29::346  4.4e-21 28.8% 0047270 00472701 1/1   AD(P)-binding domain                    
  35::347  5.3e-21 35.3% 0040035 00400351 1/1   AD(P)-binding domain                    
  41::339  1.2e-20 32.2% 0036300 00363001 1/1   AD(P)-binding domain                    
  36::341  1.8e-20 31.9% 0036092 00360921 1/1   AD(P)-binding domain                    
  35::342    2e-20 28.9% 0040688 00406881 1/1   AD(P)-binding domain                    
  35::368  2.9e-20 29.0% 0040049 00400491 1/1   AD(P)-binding domain                    
  41::198  3.6e-20 32.9% 0047564 00475641 1/1   AD(P)-binding domain                    
  35::341  5.8e-20 29.8% 0043577 00435771 1/1   AD(P)-binding domain                    
  44::213  6.3e-20 33.3% 0048607 00486071 1/1   AD(P)-binding domain                    
  41::341  6.4e-20 29.5% 0046514 00465141 1/1   AD(P)-binding domain                    
  40::198  6.5e-20 35.9% 0052313 00523131 1/1   AD(P)-binding domain                    
  39::342  8.4e-20 29.4% 0044098 00440981 1/1   AD(P)-binding domain                    
  35::341  2.4e-19 28.9% 0040602 00406021 1/1   AD(P)-binding domain                    
  43::342  3.4e-19 35.8% 0037643 00376431 1/1   AD(P)-binding domain                    
  41::351    4e-19 30.7% 0053321 00533211 1/1   AD(P)-binding domain                    
  42::347  4.8e-19 28.4% 0047133 00471331 1/1   AD(P)-binding domain                    
  34::193  1.6e-18 33.1% 0052911 00529111 1/1   AD(P)-binding domain                    
  41::344  2.5e-18 27.8% 0052600 00526001 1/1   AD(P)-binding domain                    
  44::189  2.7e-18 32.1% 0045795 00457951 1/1   otide-binding domain                    
  43::392  8.3e-18 28.2% 0048771 00487711 1/1   AD(P)-binding domain                    
  39::343  8.5e-18 25.1% 0050148 00501481 1/1   AD(P)-binding domain                    
  41::342    1e-17 24.1% 0048199 00481991 1/1   AD(P)-binding domain                    
  35::253  1.3e-17 32.9% 0036459 00364591 1/1   otide-binding domain                    
  41::198  2.2e-17 30.6% 0048583 00485831 1/1   AD(P)-binding domain                    
  43::268  3.1e-17 26.4% 0046579 00465791 1/1   AD(P)-binding domain                    
  44::339  4.7e-17 29.2% 0050927 00509271 1/1   AD(P)-binding domain                    
  43::353  6.5e-17 27.0% 0049990 00499901 1/1   otide-binding domain                    
  43::316  6.7e-17 31.5% 0052963 00529631 1/1   AD(P)-binding domain                    
  38::341    1e-16 26.7% 0046057 00460571 1/1   otide-binding domain                    
  41::254  2.3e-16 33.6% 0048807 00488071 1/1   otide-binding domain                    
  44::341  7.5e-16 30.2% 0045870 00458701 1/1   AD(P)-binding domain                    
  40::256  9.8e-16 29.2% 0047141 00471411 1/1   otide-binding domain                    
  44::188  9.8e-16 33.1% 0042446 00424461 1/1   AD(P)-binding domain                    
  35::341    1e-15 28.1% 0045518 00455181 1/1   AD(P)-binding domain                    
  35::342  1.6e-15 25.2% 0046760 00467601 1/1   AD(P)-binding domain                    
  35::194  1.8e-15 28.2% 0046274 00462741 1/1   AD(P)-binding domain                    
  35::201  2.2e-15 33.3% 0040660 00406601 1/1   AD(P)-binding domain                    
  35::342  3.1e-15 26.1% 0046416 00464161 1/1   AD(P)-binding domain                    
  42::342  3.4e-15 26.6% 0038074 00380741 1/1   AD(P)-binding domain                    
  41::274  4.5e-15 25.1% 0048356 00483561 1/1   AD(P)-binding domain                    
  44::339  1.1e-14 25.0% 0045881 00458811 1/1   AD(P)-binding domain                    
  34::203    7e-14 29.1% 0047068 00470681 1/1   AD(P)-binding domain                    
  41::220  7.5e-14 30.0% 0048865 00488651 1/1   AD(P)-binding domain                    
  42::231    8e-14 27.4% 0046750 00467501 1/1   AD(P)-binding domain                    
  23::186  1.1e-13 30.6% 0048045 00480451 1/1   AD(P)-binding domain                    
  41::184  1.2e-13 35.2% 0036889 00368891 1/1   AD(P)-binding domain                    
  40::341  2.9e-13 24.0% 0047029 00470291 1/1   AD(P)-binding domain                    
  41::188  2.9e-13 27.5% 0047682 00476821 1/1   AD(P)-binding domain                    
  44::186    5e-13 37.8% 0048009 00480091 1/1   AD(P)-binding domain                    
  40::189  6.8e-13 31.3% 0046128 00461281 1/1   AD(P)-binding domain                    
  44::186  7.2e-13 37.8% 0053322 00533221 1/1   AD(P)-binding domain                    
  32::186    1e-12 30.4% 0048866 00488661 1/1   AD(P)-binding domain                    
  19::184  1.1e-12 30.6% 0047565 00475651 1/1   AD(P)-binding domain                    
  24::186  6.2e-12 30.3% 0038449 00384491 1/1   AD(P)-binding domain                    
  43::201  7.1e-12 30.0% 0047909 00479091 1/1   )-binding Rossmann-fold domains         
  35::192  7.4e-12 27.9% 0044413 00444131 1/1   AD(P)-binding domain                    
  35::344    1e-11 20.3% 0039664 00396641 1/1   AD(P)-binding domain                    
  43::239  1.7e-11 26.4% 0046156 00461561 1/1   otide-binding domain                    
  44::342  1.7e-11 26.2% 0048364 00483641 1/1   AD(P)-binding domain                    
  40::191  3.1e-11 32.3% 0045519 00455191 1/1   AD(P)-binding domain                    
  18::187    5e-11 29.9% 0048584 00485841 1/1   AD(P)-binding domain                    
  41::188    5e-11 35.5% 0050961 00509611 1/1   AD(P)-binding domain                    
  44::258  6.3e-11 30.3% 0050960 00509601 1/1   AD(P)-binding domain                    
  42::186  7.1e-11 33.3% 0036301 00363011 1/1   AD(P)-binding domain                    
  35::188  1.4e-10 26.3% 0047327 00473271 1/1   otide-binding domain                    
  17::172  1.5e-10 30.7% 0036654 00366541 1/1   AD(P)-binding domain                    
  43::169  2.3e-10 39.2% 0048365 00483651 1/1   AD(P)-binding domain                    
  42::186  2.8e-10 34.8% 0048200 00482001 1/1   AD(P)-binding domain                    
  18::307  5.7e-10 24.3% 0050364 00503641 1/1   AD(P)-binding domain                    
  39::185  2.3e-09 30.3% 0044705 00447051 1/1   AD(P)-binding domain                    
  42::203  3.5e-09 29.8% 0048016 00480161 1/1   otide-binding domain                    
  19::186  5.5e-09 30.6% 0046972 00469721 1/1   AD(P)-binding domain                    
  26::187  1.8e-08 26.6% 0046761 00467611 1/1   AD(P)-binding domain                    
  43::186  3.2e-08 33.7% 0049679 00496791 1/1   AD(P)-binding domain                    
  45::186  3.6e-08 36.9% 0047271 00472711 1/1   AD(P)-binding domain                    
  43::186  1.1e-07 29.9% 0038468 00384681 1/1   AD(P)-binding domain                    
  39::79   4.7e-07 39.0% 0045481 00454811 1/1    N-terminal domain                      
  45::172    8e-07 30.7% 0041940 00419401 1/1   AD(P)-binding domain                    
  45::187  3.1e-06 28.4% 0040619 00406191 1/1   AD(P)-binding domain                    
  19::186  3.9e-06 27.0% 0046973 00469731 1/1   AD(P)-binding domain                    
  33::201  9.3e-06 25.0% 0046344 00463441 1/1   AD(P)-binding domain                    
  45::192  3.7e-05 24.1% 0036016 00360161 1/1   AD(P)-binding domain                    
  44::153  4.6e-05 23.9% 0047276 00472761 1/1   )-binding Rossmann-fold domains         
  42::172  6.1e-05 33.3% 0048108 00481081 1/1   AD(P)-binding domain                    
  43::78   9.4e-05 36.1% 0042342 00423421 1/1   )-binding Rossmann-fold domains         
  46::87   0.00011 33.3% 0037437 00374371 1/1   )-binding Rossmann-fold domains         
  45::155  0.00016 28.4% 0035290 00352901 1/1   )-binding Rossmann-fold domains         
  46::256  0.00026 23.5% 0044559 00445591 1/1   )-binding Rossmann-fold domains         
  17::74   0.00027 19.0% 0042366 00423661 1/1   )-binding Rossmann-fold domains         
  30::172  0.00035 27.5% 0038285 00382851 1/1   AD(P)-binding domain                    
  36::79   0.00052 34.1% 0052964 00529641 1/1   AD(P)-binding domain                    
  46::82   0.00052 37.8% 0048035 00480351 1/1   )-binding Rossmann-fold domains         
  44::178  0.00078 23.1% 0050910 00509101 1/1   )-binding Rossmann-fold domains         
  44::77   0.00087 44.1% 0047992 00479921 1/1   )-binding Rossmann-fold domains         
  43::82   0.00097 35.0% 0036785 00367851 1/1   )-binding Rossmann-fold domains         
   1::404


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPSARHPPPFTFTSSCLHPRTGYSRPSNHQRGTEMATRTQDFDHDVVIVGASFAGAACALAAARAGLRVV
00468341   1/1  ----------------------------------smases...dydvvIiGaGpaGlsaAlrLaralgkl
00477121   1/1  ------------------------------------------ektdVaIvGAGpaGlaaAlaLaraGldv
00529261   1/1  ------------------------------------------lniksielflsiieraldeglvppsmem
00413411   1/1  ----------------------------------Mp..msseeyDvvViGaGpaGlaaAlrlaraGlkVl
00492221   1/1  ----------------------------------MmktpvliklleslladtalrlpplpplsldeeyDV
00520321   1/1  ---------------------------------------MmdeeyDvviiGaGpaGlsaAlrLaraGlkV
00503631   1/1  ----------------------------------ma..smsmkydvvIiGaGpaGlaaAlrLaraGlkvt
00464461   1/1  ----------------------------------MmplslllatalelplpalaldkkyDvvViGaGpaG
00462701   1/1  ----------------------------------MMsplllalllllpllllaldeeydvvviGaGpaGl
00490031   1/1  ----------------------------------lMlpeslleplpalsaseeydVvViGaGpaGlaaAl
00470221   1/1  ------------------------------------------myDVvviGgGiaGlaaAlrLaraGlkVl
00457971   1/1  ----------------------------------------sekydvviiGaGpaGlaaAlrlarlaglkv
00374411   1/1  ----------------------------------Mpvligllesliidtalllgllpplsaskkydvvvi
00484941   1/1  ------------------------------------------aakkydvvIiGaGpaGlaaAlrLaraGl
00359891   1/1  ----------------------------------Mk..eldeeyDvviiGaGpaGlsaAlrLaraG.kVl
00491501   1/1  ----------------------------------Mirvcpalceslvvlaaglepplpplsaskkkdvvv
00472701   1/1  ----------------------------l.edllldllsmstkkdvvviGaGpaGleaAlalarlglkvt
00400351   1/1  ----------------------------------M.......eyDvvvvGaGpaGlaaAlrLaraGlkVl
00363001   1/1  ----------------------------------------mekydvvviGaGlaGlsaAlelaragldvt
00360921   1/1  -----------------------------------pplmmdeeydvvViGaGpaGlaaAlrLaraGlkVl
00406881   1/1  ----------------------------------Ms....skeydvvviGgGpaGlaaAlrlaraGlkvl
00400491   1/1  ----------------------------------Mk....dleyDvvvvGaGpaGlaaAlalaragpdlk
00475641   1/1  ----------------------------------------lldkeyDVvviGgGpaGlaaAlrlaraGlk
00435771   1/1  ----------------------------------M........kdVaviGAGiaGlaaAyeLaraGlkVt
00486071   1/1  -------------------------------------------myDvviiGaGpaGlaaAlrLaraGlkV
00465141   1/1  ----------------------------------------eieydvvViGaGpaGlaaAlrlaraGlkVt
00523131   1/1  ---------------------------------------ms..ydVvvvGAGiaGlsaAlaLarrGlrvl
00440981   1/1  --------------------------------------MeskkydvvviGaGpaGlaaAlylaraglkvt
00406021   1/1  ----------------------------------Ms......eyDvvvvGaGpaGlaaAlrlaraGlkvl
00376431   1/1  ------------------------------------------eydvvvvGaGpaGlaaAlalaraglkvl
00533211   1/1  ----------------------------------------mekydvviiGaGpaGlaaAlrlaraGlkvl
00471331   1/1  -----------------------------------------tmkydvviiGaGpaGlaaAlrlaraGlkv
00529111   1/1  ---------------------------------llsnlplgrllpfllptslwldtlplpllellisrai
00526001   1/1  ----------------------------------------MseeyDvvvvGaGpaGltaAleLaraGlkV
00457951   1/1  -------------------------------------------yDVvIiGaGpaGlsaAlrLaraGldlg
00487711   1/1  ------------------------------------------kydvviiGaGiaGlsaAleLarrGlkdV
00501481   1/1  --------------------------------------lmeleydvvviGgGpaGlaaAlylaraglkvt
00481991   1/1  ----------------------------------------klllatgslplipplegllldgvlllrtll
00364591   1/1  ----------------------------------mgrvcppcegaclllllagpvailllepaladelll
00485831   1/1  ----------------------------------------lsedkeyDVvviGgGpaGlaaAlalaraGl
00465791   1/1  ------------------------------------------mkeyDvvIiGaGiaGlsaAlrLakaGlk
00509271   1/1  -------------------------------------------vydvviiGaGpaGlaaAlrlaraglkl
00499901   1/1  ------------------------------------------kkdvvviGAGiaGlaaAlrLaeaGhkVt
00529631   1/1  ------------------------------------------mptkkdVaiIGAGpaGLaaAllLaraGh
00460571   1/1  -------------------------------------pmmskkkdvvViGaGiaGlsaAlaLaraGysVt
00488071   1/1  ----------------------------------------irvcilcelacllllllgpvlilllelaaa
00458701   1/1  -------------------------------------------ydVvvvGAGiaGlaaAlrLaeaGltdv
00471411   1/1  ---------------------------------------mstkkdvaiiGaGpaGlsaAiyLaraGlddv
00424461   1/1  -------------------------------------------vPrvlpipgidlggvlhaldfldpkal
00455181   1/1  ----------------------------------Ms......eydvvviGgGpaGlaaAlrlaeaGlkvl
00467601   1/1  ----------------------------------M......keyDvvviGaGpaGlaaAlrlarlgldkv
00462741   1/1  ----------------------------------mlM.kk....kyDviiiGaGpaGlaaAleLaraGlk
00406601   1/1  ----------------------------------Mdd..lpeeyDVvViGaGlaGlaaAaaLaraGlrVl
00464161   1/1  ----------------------------------M......leydvvviGgGpaGlaaAlrlaraGlkvl
00380741   1/1  -----------------------------------------keydvvviGgGpaGlaaAlrlaraGlkvl
00483561   1/1  ----------------------------------------MskkydvviiGaGiaGlsaAlrLaraGlkV
00458811   1/1  -------------------------------------------llydvvIiGaGpaGlsaAlrLaraGlk
00470681   1/1  ---------------------------------lllllmmmlhydvvviGgGpAGlaaAlrlarldpgar
00488651   1/1  ----------------------------------------mlpkdvviiGgGpaGleaalalarlglkle
00467501   1/1  -----------------------------------------kkkdvvvvGgGpaGltaAlrlarlgpdle
00480451   1/1  ----------------------pgldlelvltsddlldleelpkdvvviGgGpaGleaAlalarlgakvt
00368891   1/1  ----------------------------------------ppipglellltsddalellelpkdvvviGg
00470291   1/1  ---------------------------------------lllllslsllllllsslllmmskeyDvviiG
00476821   1/1  ----------------------------------------lallslllllllglllalpdlamdkeyDvv
00480091   1/1  -------------------------------------------ppipglegvltsrdlldllelpkdvvv
00461281   1/1  ---------------------------------------glellllslltemmskeyDvvvvGaGpaGlv
00533221   1/1  -------------------------------------------ipgldlegvltsrdlldllelpkdvvv
00488661   1/1  -------------------------------srprvlpipgldlegvlllrtlldsdallellalpkdvv
00475651   1/1  ------------------pipgldlegvltsrdlldllel..pkdvvviGgGpaGleaAlalarlgakvt
00384491   1/1  -----------------------lpgvellltsddalaleelpkdvvviGgGpaGleaAlalarlglkvt
00479091   1/1  ------------------------------------------mmsylplfldlkgkrVliiGgGpaGlta
00444131   1/1  ----------------------------------Ms....dedyDviviGaGiaGlvaAarLakaGlkVl
00396641   1/1  ----------------------------------MsylasaallaalpslletieyDVlviGgGpaGlsa
00461561   1/1  ------------------------------------------gkkvaviGaGpaGlaaAllLakalpghd
00483641   1/1  -------------------------------------------ydvviiGgGpaGltaaiylarlgpdlk
00455191   1/1  ---------------------------------------ppipgvellltsddalalkelpkdvvviGgG
00485841   1/1  -----------------rPrvppipgldlvltsddlldleelpkdvvviGgGviGleaAlalarlgakvt
00509611   1/1  ----------------------------------------lPrllpipglegvlllrtlldsdlllelle
00509601   1/1  -------------------------------------------kdvvviGgGpaGleaAlalar.glkvt
00363011   1/1  -----------------------------------------ppipgldlegvftlrtlddalalrealla
00473271   1/1  ----------------------------------M........yDviviGaGiaGlaaAyrLakaGlkVl
00366541   1/1  ----------------vlpipgldgegvltsrdlldllel..pkdvvviGgGpaGleaAaalarlgakvt
00483651   1/1  ------------------------------------------ipgldlpgvlllltsddalallelllla
00482001   1/1  -----------------------------------------llpipglevltsdgaldllelpkdvvviG
00503641   1/1  -----------------epklPdipGledFkgelfhsarwphdlvdltgkrVaviGaGpaGlaaaaelak
00447051   1/1  --------------------------------------arprllpipgedlflgkgvltsatilgalllf
00480161   1/1  -----------------------------------------tgkkVavvGaGpAGlaaAaqLaraldlse
00469721   1/1  ------------------dlpgve....llltsddalalkelpkdvvviGgGpaGleaAlalarlgakvt
00467611   1/1  -------------------------gvlllltsddalalkelpkdvvviGgGyiGleaAlalarllpega
00496791   1/1  ------------------------------------------Pgipgleeflgkgvhtsatldglefrgk
00472711   1/1  --------------------------------------------Prlpdipglelflgkgvhtsatldgl
00384681   1/1  ------------------------------------------gkdVaViGaGpaGldaAlylarlgakkv
00454811   1/1  --------------------------------------tdlkgkrVvViGaGlsGlaaarlllrlGaevt
00419401   1/1  --------------------------------------------lPdipglelvltsddalelkepkkvv
00406191   1/1  --------------------------------------------prvlpipGedlcgvlslrdfvgdynl
00469731   1/1  ------------------dipgle....llltsddalalkelpkdvvviGgGyiGleaAaalarlgaevt
00463441   1/1  --------------------------------vviatgsapvvitqlpipgadlarvltleevllgkakt
00360161   1/1  --------------------------------------------prklgiPGedlpgvfsardfvawyng
00472761   1/1  -------------------------------------------ysrplllgligllgakvlpgkkvaviG
00481081   1/1  -----------------------------------------aalliliaslglellpadylvlaigssdg
00423421   1/1  ------------------------------------------ldllplfldlrgkdvlviGgGdvGlaaa
00374371   1/1  ---------------------------------------------agrlavleaalllervltglgalag
00352901   1/1  --------------------------------------------fgalnlgrlllgllglvpctplgile
00445591   1/1  ---------------------------------------------pkkvaviGaGgvGlalAlllaaagg
00423661   1/1  ----------------lplelgalvltlatavralllagvlpgakVlvlGaGvvGlqaaalakalGageV
00382851   1/1  -----------------------------srPrvlpipgldlegvlllrtledalellellelpkrvvvi
00529641   1/1  -----------------------------------ePripdipglleefkgkvlhsaayrdpedfkgkrV
00480351   1/1  ---------------------------------------------gllldtallvllllllllldlkgkv
00509101   1/1  -------------------------------------------mkigiiGaGnmGralaagLlkaGhsev
00479921   1/1  -------------------------------------------pkkvaviGaGavGlalAlalaraGaag
00367851   1/1  ------------------------------------------kgkkvlviGaGgiGralaraLaeaGaev


                         -         -         *         -         -         -         -:140
query           VLERKTDPGSKLHTTGILVKEAAEQTWLGRAPADCLRRIEKVHLYSPALRSLALAAPGYYFLTTDTPNLM
00468341   1/1  pGlkVtvlEkgprpggrsrggglypgglellrelgl.edeleelgvdflkalvvlldldlvlalrllgpd
00477121   1/1  tvlErrdrpggtalgrggalsprglelleelglldallargvpldglvvvdgggrlaldfaelalgapgy
00529261   1/1  mmekydvvIiGaGpaGlaaAlrLlqlAaraGpdlkVtvlEkgdrlGGtsrtnggliprgleelldelgip
00413411   1/1  llEkgpvlgGtssrnqggirldlgaipldlleelgldlvkggdgltleagalvlatgarpripplpglgv
00492221   1/1  vvvGAGpaGlaaAyeLarapGlkVlvlEkgdrlGGtsrnggvipdgglld.......pelldlleelGl.
00520321   1/1  lvlEkgpllggtsglngggihaglskllldlrdlleelgvelllggaglvdprgvellgelgleadalll
00503631   1/1  vlEkgprlGgtwrt................grypglllllpallyllldlpllfglpppggggvdraell
00464461   1/1  laaAlalaraGlkVlllEkgdrlGGtsltaggilldlgarlleglglldlleelleelgielr....llr
00462701   1/1  aaAlalaraGlkVlllEkgdrlGGtslrsggilldgglrlleglglldrleelleelgield.....llv
00490031   1/1  alaraGlkVlllEkgprlggtsclnggglppgglrylaglglldlleelaeelgidld.....flrdgll
00470221   1/1  vlEagdrlGGrlrtvrlgggtsldlggivfpgl......ypallelleelglelallaldgellayldgl
00457971   1/1  lliekg.rlgglllllayggil......................................lrvgfiplkr
00374411   1/1  GaGpaGlaaAleLaraGlkVtvlEardrlGGrlrtaripglgasldlggilfpglsprllellaelglea
00484941   1/1  kVtvlEkgdrlGGrsrtggypgfpiidsgallfpellpyllellkelglelrl........pdlggrvvv
00359891   1/1  vlEkgpvlggtsglngggipgglllddllerlgedlliglallvdgdlvvvltgeg.leadalllatGa.
00491501   1/1  iGaGpaGlaaAyrLaraGlkVtvlEardrlGGrsrtaglippgflldlgahvfpglaplllelleelgle
00472701   1/1  lierg..lGgtllnggpglskpll.....................................lrvlgpela
00400351   1/1  vlErgdrpGGtsltnggpgfkldlgaalllgpelleelgteaael..laergvrvlrgkglgggstinad
00363001   1/1  vlergprlggcllllsvp..........................................ggrldpeelv
00360921   1/1  vlEr....gGrlasgripgklldggahllpglleellaglgdlaellalkpelvalledgaailllprgv
00406881   1/1  llekgdrlgglllagcipgkallaaalllrllellaelgiellllpypgvdlslv...plllrvlgaela
00400491   1/1  valiekgplgggasclngggipakllledllerlvvdll..kggailvdedlvelldgealeadalllat
00475641   1/1  vlllEkgdrlgGtclnsgcipskalllaalglllllgaalfglllllllllldlvllgaakralgae...
00435771   1/1  vlEardrlGGrsrtvgypgfrldlgaglipgsypyllelleelglelair.lntevggavllpdg.gllt
00486071   1/1  lvlEk.drlGGtc......lnvgcipskallyagllpdelelleelglpllpgldipvlpgrkgggreel
00465141   1/1  viEkgprlggclnvgcipgkaldaaalllrllelleelgvelr..........lppldglllpgvgdvlg
00523131   1/1  llergdvlggascrnsg..........gglakgllleelpal...................ggvdrarla
00440981   1/1  llekgprlggllntgcgp.....................................sklllpgallgaelv
00406021   1/1  llEkgdrlggtsllgggllnagdildklgllaallvrladalvlatga.rprrlgipglelpggrvvvig
00376431   1/1  llekgprlg..gllvglipsklll.....................................lrvlgaela
00533211   1/1  vlEkgprpgglsrlnggggaaldlpsklllrlldll........lelaellarlgaevlrlllglltlle
00471331   1/1  lllEkgprlgyktllalGgllltvglipgkallgaalllelaelleelgvevtllellggdrvlprldld
00529111   1/1  leralpdldmdkeyDVvIvGAGpaGLsaAyyLakarPglkVlvlEkgdrpGGasgrnggil.......ps
00526001   1/1  lllEagdrvgGtslrngglphkg..lreladrlielleelgvelllntvvgalltlaellaeydavvlal
00457951   1/1  selkVtvlEkgdrlGGtsglnaglippglggplddrglalae.etlellrelgaelglldglvrpngalv
00487711   1/1  tvlErgplpggggasgrnagllhaglaylelarlaresldllrelveelgidfrrygklvlatgeaelel
00501481   1/1  liekgplllyalgglllyvgcilskall....................................llgilg
00481991   1/1  dalallemlkkeydvvviGgGpaGlaaAaylarlGlkvlliekgprlggtclnvgcipskallkaaelae
00364591   1/1  gllplllpamskkkdvvvvGaGpaGlaaAlalaraGlkvtllekgdrlggrlllvg..............
00485831   1/1  kVlllEkgpelggtclaaggipskallllalgllllelaallgillllllld...........lllllrr
00465791   1/1  VlvlEkgdrpGgrgasgrnaggiapglgyddrllalakeslellkelgaelgidlfrppgklvvaggg.d
00509271   1/1  sevlllek.drlggtil.........................................llggvpsglllg
00499901   1/1  vlEardriGGrsrtngg.............................llipglrldlgahlfpgsy.....
00529631   1/1  dldVtvfErrdrpGGlwrttgrigsgldlgpsllrlleelglldelleeglsplypglrldvpkelygfp
00460571   1/1  vlErgdrpggtsgtnggllaaglvapllllpggipllalalealdllrelglelgidf..rvgalvlatg
00488071   1/1  lllpllllpatkkkdvaviGaGpaGlaaAlalaraGlkVtllEardrlggrlllsgg.............
00458701   1/1  lvlEagdrvGGrartvrypgfrfdlgahvflgpgg..elleylldlleelgleddlrlntevggarlllp
00471411   1/1  tvlEkndrlgGrll..ggipg..........................................falpael
00424461   1/1  kgkkVaviGaGpaGlaaAlyLarlGaevtvierrprlgg...............tllalgripakllgle
00455181   1/1  vlEkgdrlgglsnrn......................gipglrlllgalllrllelleelgipfdlpglg
00467601   1/1  lviekgpllggqtllllggtclnvgcipskllllaallpellelleglgvefdleekgvdldg.lrlayd
00462741   1/1  VlvlEkgdrlGGtwasngipgipsdggaavilgpellellrelgi.elgpkvpeildyllklldkfdllk
00406601   1/1  vlEkrdrlGGtsatsrypGfrfdvggsllpgtipgllrllrelgledlellplglagvirgggsvvnalp
00464161   1/1  liekgdrlGGtllntgcipgkalllgalllellrellelgglflllpdldlelllelldalv.....eel
00380741   1/1  llekgdlgggclnvgcipgkrllaaaelydelrelleelgipfdevllgllll................l
00483561   1/1  lllEkgdrlGGtsgrnaglipgglrldaalllvrlalesldalreliatgarplglpipgrdlgglllar
00458811   1/1  VlvlEkGplvnrdrlGGts.nggdgrldlgahvfflllppgllellaelglplglelldlleelleelgi
00470681   1/1  vllieke..pglgynrgclp.......kklllaaaelldlllelaglgll........llvaagdldaee
00488651   1/1  vtliergdrlggtllplgpgpll........................................glldaee
00467501   1/1  vtliekgdrlggtpllpgvlggk...........................................llae
00480451   1/1  lverrdrlgglld.....................................................pela
00368891   1/1  GpaGleaAlalarlglkvtliergdrlgglld......................................
00470291   1/1  aGpaGlvaAlrLaelaGlkVlvlEaGGtarnggyigskpdlgaalfg..elldelyelgle....ldgrr
00476821   1/1  vvGaGpaGltaAlrLae.GlkVlvlEaggrlggrgatpsgggflvdtgadwlfgtep.............
00480091   1/1  iGgGpaGleaAlalarlgaevtvvergdrlgglld...................................
00461281   1/1  aAlrLaedaGlkVlvlEagdrlgGascipsgaglgadlgltllpglfdtllagldgrdllarrgkvlggs
00533221   1/1  iGgGpaGleaAlalarlgaevtvvergdrlgglld...................................
00488661   1/1  viGgGpaGleaAaalarlgakvtlvergdrlggtlld.................................
00475651   1/1  vvereprlggtld.....................................................pels
00384491   1/1  vver.drlggtl.....................................................dcils
00479091   1/1  AlelakaGakvtlverdpr...................................................
00444131   1/1  vlEkgdrlGGtaatlgldglkfdlggsvihgllypallrllrklgldlgpkilhalgelvdlllrtdvsd
00396641   1/1  AlelarlapdaGlkValvEkgdlgggasgrsgggiaaglrllienylgl...dlaellvedlvkggaglv
00461561   1/1  vtvfEkgpvpggllry...........................................giapdfrlpke
00483641   1/1  vtliek...ggtclyvgcllskalg.....................................llglldee
00455191   1/1  paGleaAlalarlgakvtlierrdrllgtl........................................
00485841   1/1  vvergdrllgtld.....................................................pels
00509611   1/1  lpkdvvviGgGpaGleaAlalarlglkVtliergdrlgg.ld............................
00509601   1/1  liergdrlggtrpllsgvipgkll..............................................
00363011   1/1  gkrvvvvGgGlaGleaAaalrrlglevtlvergdrlllpyl.............................
00473271   1/1  vlEkgdrlGGraatfrldgfrvdnvgahpfkgl....npelldllkelgledkldlrrlvllrgkvlggp
00366541   1/1  vvergdrlggtld.....................................................pels
00483651   1/1  kpkdvvviGgGpaGleaAlalarlGakVtviergdrlggrlld...........................
00482001   1/1  gGpaGleaAlalarlglkvtlvergdrlggtl......................................
00503641   1/1  aglevtvfertprigglwrgipypp.............................................
00447051   1/1  kgkdvvviGgGpaGleaAlylarlgakvtlierrdrlggtl.............................
00480161   1/1  elghdvtvferlprpgg.llrygiapdfrlpk......................................
00469721   1/1  liergdrllglld.....................................................pels
00467611   1/1  kvtlvergdrllpcld.....................................................p
00496791   1/1  dvvviGgGpaGleaAlylarlglkvtlierrdrlggd.................................
00472711   1/1  lfkgkdvvviGgGpaGleaAlalarlglkvtllerrprlggtl...........................
00384681   1/1  tlverrdrlg.........................................................fpa
00454811   1/1  vldrrdrpg-------------------------------------------------------------
00419401   1/1  viGgGyiGleaAsalrrlgaevtliergdrllpll...................................
00406191   1/1  hpaawllppdltgkrVvviGaGpaGldaArellkdldlllktdisdnaleallarlgaevtvvgRrgpli
00469731   1/1  lvergdrll..pyldcelskall...............................................
00463441   1/1  gkrVlVvdgGgGpaGleaAealarrGheVtlvealdrlggll............................
00360161   1/1  lpdaallepdltgkrVvviGgGpaGldaArlllksldellktdindlalealkrlggkeVtvveRrgple
00472761   1/1  aGgvGlalAlalaaagaagevtlvDideekleglardlldilellgv......................g
00481081   1/1  aldlpklpkrvvvvGgGyiGlelAaalarllpelgaeVtlvergdrl.......................
00423421   1/1  rllleaga--------------------------------------------------------------
00374371   1/1  llpgkrvlViGaGgiGl-----------------------------------------------------
00352901   1/1  llerlgidlsgkvalVtGasggiGraiallLaraGatVtvtdrnten.........leeavkeaDiviva
00445591   1/1  gdVtlvDidp..............ekleglaadlldilelllve..rlitttdleealadaDvviiavgt
00423661   1/1  tvvD------------------------------------------------------------------
00382851   1/1  GgGliGlelAaalrellpklglevtlveagdrl.....................................
00529641   1/1  vViGaGaSg-------------------------------------------------------------
00480351   1/1  alVtGasggiGl----------------------------------------------------------
00509101   1/1  tvanrtpekaealaeeggvvaaslaea...ladadvvilavkpqaveevlaelag..kgalvidiaagip
00479921   1/1  eVvlvdr---------------------------------------------------------------
00367851   1/1  tvadrslekaea----------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RWLASELVNHGVDLRLGTSFSQASRSGAGWSVPGVGRTRYLVGADGARSRVAQIAGLGQGNAFLYGVEYE
00468341   1/1  vtggerrpragvvdraellralleaaeelGngrveirlgtrvtsierdgelledleeypvtvtlenlsee
00477121   1/1  vvdraellralleaaeelgveirlgtrvtsileedgdgvtvtledggeeetieadlvvgAdGarsrvrrl
00529261   1/1  gal.ldagfpydgllfvfgggfigledargllrlgagvtvvdrgd..llralaeaaeelGveirlgteVt
00413411   1/1  pgvltsdgalalrepgkrvvviggglsglellvgrgdgaalaralaeaaealgveiltgtevteilrdeg
00492221   1/1  .....pfdlllpgggvv..dpaellralaealaeelgveirlgtevtdilrdggrvtgvttedllvdkng
00520321   1/1  atGrpfdlpipglelfgvrglltlldalkleplllssdlaggllypgkrvvvigggaillealaeaaeel
00503631   1/1  dylleaaerlgvedvirlgtevtsidfdedgvvvgvttedGetieadavvlAtGalsrprlppsipgldl
00464461   1/1  dgklvvaltgegleadavllatGarprllpipgldllggrvvvigggviglelaralaeaaeelgveill
00462701   1/1  dgrlvvaladealeadalllatGarprllpipgldllgglvvvigggviglelaralaeaaeelgveill
00490031   1/1  vlaldgegleadalllatGapprlldipgldllggrvvvigggvdglelaralaeaaeelgveillgtrv
00470221   1/1  vlelgidlntlvvaldpdalevlledleelradavvlAtGsrprlppipgedlggvlhsallldllgkrv
00457971   1/1  laelleallelaeklgveillgtevtdidldddvvvvltdgetitltadavvlAtGsrprllpipg....
00374411   1/1  elarllglrvlilldgtvvsldgdldfevlladgeeleadalilatGarprllpipgfdgkgvltardll
00484941   1/1  lpdgkvlgydlglgalpdspealgleefpgrvvvigggyiglelagkrvrvggakvtllqrrppfvlpll
00359891   1/1  pprlldipgldelggllsldalggrvvvigggviglelaralleaaeelpgveillgtevteilgdgdgv
00491501   1/1  lelltlagaavlalldgklidlpadvarllaarlvrlldgleleadalilatGarprlllpipgldlfgv
00472701   1/1  eylrelleklgveillgtrvtsidrdgdtgrvtgvtledgetleadavvlAtGars..............
00400351   1/1  avvlatgadprllgipgldydfllpgvhsaedalgldllgkrvvviGggysgvelaealarlgapvtlld
00363001   1/1  lalaelleelgvevrlgtevtsidrdgdgvtledgetleadavvlAtGarprvlll..............
00360921   1/1  rllaglglggssainagvylrvspadfdelgawgvtlddlepyfelaadalvlatGsrprlpplpglelg
00406881   1/1  aalaealeelgveillgtav..ve.dggrvtldgetieadlvvlAtGarsllll................
00400491   1/1  Garpr.lgipgsdlpgvllalgkrvvvvgggviglelaaalaealealpgveillgtevtellgdggrvt
00475641   1/1  llrllaelaeklgveillgtavtellkddggvvvtgdgetiradavilAtGarsrvpp------------
00435771   1/1  vprdladllaellaladgllleadavilAtGarprlppipgldlkgvltsrdlldllgkrvvviGgGasg
00486071   1/1  lrylaealeklgveirlgtalfvdpnrVts.......vtvttedGetgelvpgetiradavvlAtGarpr
00465141   1/1  aelaaalaealeelgveillgtrvtei.d.ggvvgvttedgetieadavvlAtGars.............
00523131   1/1  aalaeaaealgveirlgtevtdllleggrvtgVrtadGetlradavvlAtGafsrlll------------
00440981   1/1  eallelleelgveillgtevtsidldgggv.vltdgetieadavvlAtGarprllglpgldlpggl....
00406021   1/1  ggvialeeaaeelgveiltgtevtei..dg.vvgvvledGeeltieadlvvlatGarsnlrl........
00376431   1/1  aalaealeelgvevllgtevtsidrdgggvtgvllvttgdgetiradavvlAtGarpntplleglgleld
00533211   1/1  rgdrllpellrallealeelgveirlgt.vtei..dggvvgvtledGeeetleadlvvlatG..svvrll
00471331   1/1  gpellkallealeklgv.illgt..veilgddggvgvtledGeeetieadlvvlAtGglsrvrlll....
00529111   1/1  glltdellellee........lgipfdpegpgggtvdgaalvralaeaaleel-----------------
00526001   1/1  glglatglagrglavprgrvlggssvingavylradaidfatgargipgwdldgvlpyfdrledslgvlg
00457951   1/1  laigledadelarlgkrvavlgggellladgvtgglrpdggrvdparlv---------------------
00487711   1/1  lrelaealralgvdvelldaaelraleplldlpdllgglyvpdggvvdpaalaaalaraaealGveirlg
00501481   1/1  eellarlreqleklgveillgtrvtsidldggtvvltdgetieadavilAtG..................
00481991   1/1  liellpglgvelllgglgldlaellerkdavv..dgeelaaalaelleelgvevllgtav.ii.ddgtvt
00364591   1/1  ............................gipggvlpeelvealaelleklgveirlgtrvt....dg..v
00485831   1/1  llllllllaagvegllillgvevvvgvadgggvtvvtgdgetiradavilAtGarsrv------------
00465791   1/1  iglllelaealrrlgvpvellspeelkellplldfpeflgglytprggtvdpaelvralleaaeelGvei
00509271   1/1  aalllallelleklgveillgtevtsidld..ggtvvgvttgdgetltad..vlAtGarprllllllvpg
00499901   1/1  ellldlleelgvelrlntrvv.vdrdgklvtvpldldgleleadavvlatGalsllprlpdipgldlf..
00529631   1/1  dfpl....pgwfpvfpgrkelldyladlaeklgveirlnteVtsverdgdgvtvttedgepdgeeetlea
00460571   1/1  laeladalllalgapprlldapelrellpvvvpgggvvdpaallealaeaaeelGveirlg.rvtsi..d
00488071   1/1  .............................ipgkvdpaellealaelaeelgveirlgtrv..........
00458701   1/1  dgkllvltsdlnalllelradalilatgalprlppipgldlgevlhsagyeellrrlgldllgkrvvvig
00471411   1/1  ldalaelaeklgveirlgtev.......dgvtvttedgetieadavvlAtGalrprllpipgldlpgvlg
00424461   1/1  alllrllllllglglllpipgrvlpkellealaealeklgveillgte----------------------
00455181   1/1  glflprggrvdgaelaaalaeaaeelgveillgtrvt.i..dggvvgvttdgetiradavilAtGalslp
00467601   1/1  klvdaelaaalaelleklgvevllgt.vteiegddgrvtgvvvvrledgetleadlvilatGglsllll.
00462741   1/1  lleflskvngveyiegrasfldagkwevltedgwgifeeeltadaviiatGarp----------------
00406601   1/1  deaeallaelgvlfpigyaellpfyerleklygvlgegylpdlpgasifkglpvhssfddr---------
00464161   1/1  aaalaealeelgveillgtevt.i..edgrvgvtledgeeltleadlvilatGrrslP............
00380741   1/1  grggadgaelaaalaelleelgvevllgtavt.i.ddgrVtldgetitadavilAtGarprll.......
00483561   1/1  daldldalpkrlavlgggllgvdelaellpllgsevtgglrsprggtvdparlvralaeaaeelGveill
00458811   1/1  dfllgkgvgglsaingvvlergsaedydalipatgaedflgglflpaegilgatgsepfllpgvsllrvl
00470681   1/1  lvlalaelleelgvevllgtrvtgidpdg..vtvtladgetitadklvlAtGarprllpipgl-------
00488651   1/1  laeylrelleklgvevllgtevtsidgdgkgvtledgetleadlvvlatGarpntppipgldllgvldvr
00467501   1/1  lllrllelllklgvevllg.evtsidpdgktvtledgetleydllvlAtGarprllpipgldlegvltlr
00480451   1/1  aallelleklgvelllgtrvtaidldgggvtvtledgetleadlvv------------------------
00368891   1/1  ...............pelaaallelleklgvevllgtevtaidv--------------------------
00470291   1/1  llfprgkvlGGsssinggvylrgskndfdlwaglaglegwsydellpyfkkaekliiatgsrpllpdlpg
00476821   1/1  ...elglegrgillprgkvlGGsslinggvlvrglpedfdalglgwsy----------------------
00480091   1/1  ..................eelsllllelleklgvelllgtrvtaid------------------------
00461281   1/1  slingmvylrglpedldelakllgvegwgydellpyfkvaedglgltad---------------------
00533221   1/1  ..................eelslallelleklgvelllgtrvtaid------------------------
00488661   1/1  ....................eelaaallelleklgvevllgtrvta------------------------
00475651   1/1  kallelleklgvelllgtevtaidgdgdgvvvvlllvdvvlgdg--------------------------
00384491   1/1  kallelleelgvevllgtevteveldgggvvvvlgltvevvvlgdg------------------------
00479091   1/1  ........pelallllelleklgvevllgtrvteiakeylpelllgveveagdgvvtvvlg---------
00444131   1/1  ylefrlldgrvvfpdgkvlkvptnlaellksfllglsekrrllaflgviatg------------------
00396641   1/1  dedlveilatgappavleleglgvpflrtsdgaldlkgglvavigggsiarelalaeaalklgveilegt
00461561   1/1  lldrlielleelgveirlntevgkdvtledll.....leydavvlAtGalsprllgipged.lpgvvlal
00483641   1/1  lalrllelleklgvelllgtevtsidlegktvtllllvlgdgetleydklvlAtGarp............
00455191   1/1  .............dpelskallelleklgvevllgtevteidgdg......-------------------
00485841   1/1  klllelleklgvdlllgtkvtaidrdgdgvtvvlllkdgdgetlead-----------------------
00509611   1/1  .........................pelskallelleklgvelllgte----------------------
00509601   1/1  .......deelaeylrelleklgvevllgtevtsidgdgkgvtlddgeleadavvlatGsrpntpllpgl
00363011   1/1  .......................rpelskallelleelgvelrlgt------------------------
00473271   1/1  sdlngllavrgdedlleakalllatgpylpllpglsleevldsllgld----------------------
00366541   1/1  kallelleklgvevllgtevtaidvdgdgvtv--------------------------------------
00483651   1/1  ..........................eel-----------------------------------------
00482001   1/1  ...............dpelsklllelleklgvevllgtevtaiegd------------------------
00503641   1/1  lgkelldyleeyarklglrirfgtevtsvdr..dgwtvtgeeltleadavvlatGa.svprlpdipgldl
00447051   1/1  .............................dlllelleklgveill-------------------------
00480161   1/1  ....evvdrlvdlledlgvefvlnvevgvd.vtldel....lleydavvlAtGatkprllgip-------
00469721   1/1  kallelleklgvelllgtevtaidldgdgvtvvtledgetleadlv------------------------
00467611   1/1  elsklllelleklgvdvllgtevtaidvddktvtvvtledgetlead-----------------------
00496791   1/1  ......................pelleyllelleklgveillgtev------------------------
00472711   1/1  ...............................dlllelleklgveil------------------------
00384681   1/1  fpelvellkeegveillgtavleilgddgkvtgvrvvrveldesgr------------------------
00454811   1/1  ----------------------------------------------------------------------
00419401   1/1  ..................deelsllleellee--------------------------------------
00406191   1/1  aaftlkelerlpelggllry.......................gipe-----------------------
00469731   1/1  ....elleklgvdlllgtkvtaidrdddgvlvvvledgetleadlv------------------------
00463441   1/1  .........................rlgipdpllerleelgveillgvavteilgdgvelg---------
00360161   1/1  apftlkelrelggllrygippdpldlallelelellpraldrlv...ellld------------------
00472761   1/1  lvvttdleealkg---------------------------------------------------------
00481081   1/1  ..............................lp--------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00352901   1/1  vgvpglvkaellkpg-------------------------------------------------------
00445591   1/1  prkpgmlrldlladnlgivkavaealakllkpgvil..................................
00423661   1/1  ----------------------------------------------------------------------
00382851   1/1  ...............lpryldpelsklllell--------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00509101   1/1  ieelaealpeaglvvrdmpnlgalvgagataltllagg--------------------------------
00479921   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FAGLQLSDPDALHCFASKHFAPGYIGWVAQNPTGVQAGLALRHAPRRRAAPDIDGFLRRVRHLLGVPEDA
00468341   1/1  eakpeelggkvagvllrklledgddgrvtvttedldtgGeeetiradlvvlAtGarsllrkllglelpgg
00477121   1/1  lgip..................................................................
00529261   1/1  sierdedgrvtgVttedmeplkdGeekpvpveGetiradlvvlAtGarssprlllleglgle.dgrgyi.
00413411   1/1  grvtgVvtadtkdGeevtiradavvlatGafsnlrlllglglgltgdglalalrlgaplpdggflqfh..
00492221   1/1  vevtdgdggtiradavvlAtGarprllelpgldlpgvpdalgilvleglplvlpenl-------------
00520321   1/1  GveiltgtevteierdggrvtgVtvrdtadGeeetiradlvvlatGarsnvrllglsglglpgdgyalai
00503631   1/1  tfkggvtlsavw........sdgalallgllvdllpkrvvviGgG.sglelasalarl.....gakvtlv
00464461   1/1  gtrvteilvdeggrvtgvttedadGeeltiradavvlatGgfpnlalllglglp................
00462701   1/1  gtrvteilvdeggrvtgvtlrdadGeevtiradavvlatGglsnlrlllglgl.................
00490031   1/1  tellvdeggrvtgvvledadGeevtiradavvlatGgfpnlrrllg........................
00470221   1/1  vvigggasgldlaellarlgaevtvvlerrdrlllffppdgqvdpaglvralaealeallgveirlgtrv
00457971   1/1  ..............................................................ldl..egv
00374411   1/1  dllflgkrvvviGggvsglelaealarllkilgaevtllersdrllallddegqvdprg...lldalaea
00484941   1/1  llglllllllllglspdhligagplrggcdyrgggvfgcpggaglvlggrgslaeallealeelpGveir
00359891   1/1  tvttgrvtgvvlrdladGeevtiradlvvlatGarsnllllllsgigptgdglalleraglelvde....
00491501   1/1  lgrvllssdlllgllllgkrvvviGggaiglelalalarlgaevtlversprlgpvlpaglsealaeale
00472701   1/1  ....................................................................np
00400351   1/1  rsplarlppgllspgdglldggdgalvaalaealerlgveillgtrvteilrdgggvtgVttedgeleld
00363001   1/1  ...............................................................pglelle
00360921   1/1  gvlltaaealgldflgkrvvvigggasgvelasalarlgagvtvvyrpdggrgalaralaraaeaagvtv
00406881   1/1  ..........................................................grrpntelllle
00400491   1/1  gvvledgetgeevtiradavvlatGgrpnlellltnppgntgdglalleraglel...............
00475641   1/1  ----------------------------------------------------------------------
00435771   1/1  ldiaealarlgaevtvverrprllalldalalllgllsldalaalepllalellggllypdggpaalvea
00486071   1/1  vpp-------------------------------------------------------------------
00465141   1/1  ............................................................lllllgrrpn
00523131   1/1  ----------------------------------------------------------------------
00440981   1/1  ......................................................................
00406021   1/1  .................................................................llgld
00376431   1/1  erggivvde.tlrtsvp.....................................................
00533211   1/1  lg....................................................................
00471331   1/1  ...................................................................vrp
00529111   1/1  ----------------------------------------------------------------------
00526001   1/1  lpflgkrvvviGggpigvefaealarlgakvtlvergglllpgdgvgdraslaralleaaealgveiltg
00457951   1/1  ----------------------------------------------------------------------
00487711   1/1  tevtgierdggrvtgVrtadGeieadlvvlAaGawsnellellglelpp.....................
00501481   1/1  ..........................................................vlvaigrrpnte
00481991   1/1  vdgetieadlvilAtGarprlpplpg............................................
00364591   1/1  gvttedgetieadavilAtGarpntllllrggivvdeylrtsv---------------------------
00485831   1/1  ----------------------------------------------------------------------
00465791   1/1  llgtevtsierdgdgvtVttedGtiradlvvlAtGawgspllkllglp.....lepvr------------
00509271   1/1  ipgfdgkgvhtartlldld.................llgkrvvviGggaiglelal..............
00499901   1/1  .........sleellsalgll.....dllgkrvvvigggasgvdlaellarlgarvtllerldglllpgd
00529631   1/1  daVvlAtGalsrprllgllpdipgldl...........fggrvlhsalyldn..................
00460571   1/1  G......etleadlvvlatGags..rellg.......dlglepvrggfivvdpp................
00488071   1/1  DdgetiradavvlAtGarprllplpgld................--------------------------
00458701   1/1  ggasavelaalaragasvtlllrsprlglltprggygalvealakalendylealarlgveirlgtrvte
00471411   1/1  vhsll............savllgllllgkrvvvigggdigllaela------------------------
00424461   1/1  ----------------------------------------------------------------------
00455181   1/1  lll...................................................................
00467601   1/1  ......................................................................
00462741   1/1  ----------------------------------------------------------------------
00406601   1/1  ----------------------------------------------------------------------
00464161   1/1  .................................................................lllpn
00380741   1/1  ...................................................................glp
00483561   1/1  gtevtsierdggvvgVttedGeiradlvvlAtGawspellkllgielplgl.....lpvrgqil------
00458811   1/1  dsagalslafrgkrvvvrltyddnyfndeyqglpereklltlviiGgGndpgklaralaealekrlGvei
00470681   1/1  ----------------------------------------------------------------------
00488651   1/1  gaivvdellq------------------------------------------------------------
00467501   1/1  tlldalalrealldlllllkg-------------------------------------------------
00480451   1/1  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00470291   1/1  glllggdgiltselalsldllpklvvvigggaiglelapvlarlgakvtgvgrlprglpvgdgglsalva
00476821   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00533221   1/1  ----------------------------------------------------------------------
00488661   1/1  ----------------------------------------------------------------------
00475651   1/1  ----------------------------------------------------------------------
00384491   1/1  ----------------------------------------------------------------------
00479091   1/1  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00396641   1/1  evtellgdgdgkgrvtgvvtkdlktgevgtiradavvlatGgagnlllllsvlepdlrttnpptntgdgl
00461561   1/1  dflllgnllpgkrvvviGgalrlldgvig-----------------------------------------
00483641   1/1  ..............................................................vvvaigvt
00455191   1/1  ----------------------------------------------------------------------
00485841   1/1  ----------------------------------------------------------------------
00509611   1/1  ----------------------------------------------------------------------
00509601   1/1  elder...ggilvdetlrtsvpg...vfaagDvagkpvlvvgagaegr----------------------
00363011   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00483651   1/1  ----------------------------------------------------------------------
00482001   1/1  ----------------------------------------------------------------------
00503641   1/1  fggllahsflrrkirelvkdpelaelltplllflgkrvvvigggysgv......................
00447051   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00469721   1/1  ----------------------------------------------------------------------
00467611   1/1  ----------------------------------------------------------------------
00496791   1/1  ----------------------------------------------------------------------
00472711   1/1  ----------------------------------------------------------------------
00384681   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------
00406191   1/1  ----------------------------------------------------------------------
00469731   1/1  ----------------------------------------------------------------------
00463441   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00445591   1/1  ..............................................------------------------
00423661   1/1  ----------------------------------------------------------------------
00382851   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           APTTTRAGLIPCGGPVYPLARDGVLLTGDAAGIVSPVTAGGIHAAWRHGEAVGRAIAAHLRTGAATPEQV
00468341   1/1  gv....................................................................
00477121   1/1  ................................prtsvgrvflaGDaahavhplggqGlnlAiedarllae
00529261   1/1  ......................................................................
00413411   1/1  ......................................................Pthytmg---------
00492221   1/1  ----------------------------------------------------------------------
00520321   1/1  rvgeplpdhl...................................................---------
00503631   1/1  errprll---------------------------------------------------------------
00464461   1/1  ..p.........hP.dgrllfg...prd...................d...dellrllpg----------
00462701   1/1  ..P.....i...f..Pdgrlllgpr...................pd.delrellpgl.gval--------
00490031   1/1  .........ldlpllpvrgtalalgatgdglalleragvelddrgfvqffPtllgivvdetl--------
00470221   1/1  teierdgggvtVttadGetieadlvvlatGarsllrllglpglg........leldpagerlpdg.....
00457971   1/1  ltsptsildalalllellpgklvviggGaivllaigrrpntellglegagleldrggivvd.--------
00374411   1/1  leellgveirlgtrvteierdgggvtvtledgdgeeetieadlvvlatGars.ltellgl..--------
00484941   1/1  lgteVteiegdgggvtVttedGeeieadlVilatGarsslrlledsglppd..........---------
00359891   1/1  ...............................................................rggivvd
00491501   1/1  allGveirlgtrvteierdgggvtvttedGdgeeetieadavvlatGarpllrlledlg...--------
00472701   1/1  nilglegagllderggivvd.etlrtsvpgvfaaGdvaggp....lglavvAiaeGrvaalniagl----
00400351   1/1  geevtiradavvlatGarssprllllsgigpaellkalgielpl................dlpgvge---
00363001   1/1  gagleld..ggivvdeylrt.svpgvyaaGdvagvplpllglggggglaavAllsgrva-----------
00360921   1/1  ltgtrvteierdggggrvtgVtledgegltgeevtiradlvvlaaGarsttrllllsglgl---------
00406881   1/1  lagleldrggivvde.tlrtsvpgvyaaGdaag...g..grgaavAiasGrlaaeaiagyle--------
00400491   1/1  .........................................................hdtrggivvdetl
00475641   1/1  ----------------------------------------------------------------------
00435771   1/1  laeal.e.gveillgtrvteierdgggvtvttedadgslkpvledgetieadavvlatGar---------
00486071   1/1  ----------------------------------------------------------------------
00465141   1/1  tellglegaglelderggivvde.tlrtsvpglyaaGdaag...g..gglvatAiasGrla---------
00523131   1/1  ----------------------------------------------------------------------
00440981   1/1  ealglelderggivvde.tlrtsvpglyaaGdvaggpgp....lavtAlasGrlaalniagy--------
00406021   1/1  lpkelleglgleldtrggivvdetlrts.vpglyaaGdaagp.....gqgvatalasGrla---------
00376431   1/1  ..............................glyaaGdaaggvnp....lagvAlasGrlaal--------
00533211   1/1  .....vrpnlegllleglglelderggivvd.etlrtsvpgvyaaGdaaggp.....klavvAlasGrva
00471331   1/1  ntellglealgleldierggilvd.etlrtsvpgvfaaGdavhgappl....avvAlaeGrlaaeni---
00529111   1/1  ----------------------------------------------------------------------
00526001   1/1  trvteilrdedggrvtgVetrdladGeeftiradlVvlaaGaipsprllllsGigl........------
00457951   1/1  ----------------------------------------------------------------------
00487711   1/1  ................................................................pdglpv
00501481   1/1  llkl..glelderggivvdelllrtsvpgvfaaGdvaggplr....lavvAvaeGriaalaia-------
00481991   1/1  ............................grrpntelleaaglelderggivvde.tlrtsvp--------
00364591   1/1  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00509271   1/1  ....igvrpntegllledaglelderggilvde.tlrtsvpglyaaGdvaggp.....g-----------
00499901   1/1  gvldpkgglgallealleelgveillgtpvteiGeleadavvlatgldplaellglelperglivvdpgl
00529631   1/1  ....................................----------------------------------
00460571   1/1  ........................................dpeilrrwvglrpltpdglpl---------
00488071   1/1  ----------------------------------------------------------------------
00458701   1/1  ilrdgggvtvttadGetieadavvlatgarplaellgllgpe...................---------
00471411   1/1  ----------------------------------------------------------------------
00424461   1/1  ----------------------------------------------------------------------
00455181   1/1  .......glspntpgllleglgielderggivvde.nlrtsvpglyaaGdvagg.....gn---------
00467601   1/1  .lgrrpntellgleaaglelderggivvde.tlrtsvpgiyaaGDvagg.....prlaavAl--------
00462741   1/1  ----------------------------------------------------------------------
00406601   1/1  ----------------------------------------------------------------------
00464161   1/1  tellgleklgvelderggilvd.etlrtsvpglyaaGdvagg.....grlavvaiaeGrlaa--------
00380741   1/1  gitptllleaagvelderggivvd.etlrtsvpglyaaGdvagg.....grlavvAvaeGrl--------
00483561   1/1  ----------------------------------------------------------------------
00458811   1/1  rlgtevteierdeggrvtvttedgetkdvlgeeeeieadlvvlaaGarpstrlllls..-----------
00470681   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00480451   1/1  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00470291   1/1  alakalerlgveiltntrvtrilvdggggglrvtgVetedgggeektiradkeVilaaGai---------
00476821   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00533221   1/1  ----------------------------------------------------------------------
00488661   1/1  ----------------------------------------------------------------------
00475651   1/1  ----------------------------------------------------------------------
00384491   1/1  ----------------------------------------------------------------------
00479091   1/1  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00396641   1/1  alalraglelaglelfvqfhptglitepvrg.................................------
00461561   1/1  ----------------------------------------------------------------------
00483641   1/1  pntgllk.aglelderggivvde.tlrtsvpgiyAaGDvagvpglllgllllpklaavAvaq--------
00455191   1/1  ----------------------------------------------------------------------
00485841   1/1  ----------------------------------------------------------------------
00509611   1/1  ----------------------------------------------------------------------
00509601   1/1  ----------------------------------------------------------------------
00363011   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00483651   1/1  ----------------------------------------------------------------------
00482001   1/1  ----------------------------------------------------------------------
00503641   1/1  ...........................-------------------------------------------
00447051   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00469721   1/1  ----------------------------------------------------------------------
00467611   1/1  ----------------------------------------------------------------------
00496791   1/1  ----------------------------------------------------------------------
00472711   1/1  ----------------------------------------------------------------------
00384681   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------
00406191   1/1  ----------------------------------------------------------------------
00469731   1/1  ----------------------------------------------------------------------
00463441   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00423661   1/1  ----------------------------------------------------------------------
00382851   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AEQSAPRFRTKRLLRWAFDHFQSDWAFDVLLHSAPLRWVAERIYFHKRGVAAEI----------------
00468341   1/1  .........................rtsvpdgvflaGDaahtvhp-------------------------
00477121   1/1  alaaalrg..alpaaldayererrpraaavlalsrallrlfslddpll----------------------
00529261   1/1  ............pvdlpllertsvpgvfa-----------------------------------------
00413411   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00520321   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00464461   1/1  ----------------------------------------------------------------------
00462701   1/1  ----------------------------------------------------------------------
00490031   1/1  ----------------------------------------------------------------------
00470221   1/1  ............W.........................--------------------------------
00457971   1/1  ----------------------------------------------------------------------
00374411   1/1  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00359891   1/1  eg--------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00472701   1/1  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00363001   1/1  ----------------------------------------------------------------------
00360921   1/1  ----------------------------------------------------------------------
00406881   1/1  ----------------------------------------------------------------------
00400491   1/1  rtsvpglyaaGdvagtpl----------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00465141   1/1  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00376431   1/1  ----------------------------------------------------------------------
00533211   1/1  a---------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00457951   1/1  ----------------------------------------------------------------------
00487711   1/1  igp..vtgvpglylagga..........Gvtlapasgrllad----------------------------
00501481   1/1  ----------------------------------------------------------------------
00481991   1/1  ----------------------------------------------------------------------
00364591   1/1  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00499901   1/1  rtg-------------------------------------------------------------------
00529631   1/1  ----------------------------------------------------------------------
00460571   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00424461   1/1  ----------------------------------------------------------------------
00455181   1/1  ----------------------------------------------------------------------
00467601   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00406601   1/1  ----------------------------------------------------------------------
00464161   1/1  ----------------------------------------------------------------------
00380741   1/1  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00488651   1/1  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00480451   1/1  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00533221   1/1  ----------------------------------------------------------------------
00488661   1/1  ----------------------------------------------------------------------
00475651   1/1  ----------------------------------------------------------------------
00384491   1/1  ----------------------------------------------------------------------
00479091   1/1  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00396641   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00483641   1/1  ----------------------------------------------------------------------
00455191   1/1  ----------------------------------------------------------------------
00485841   1/1  ----------------------------------------------------------------------
00509611   1/1  ----------------------------------------------------------------------
00509601   1/1  ----------------------------------------------------------------------
00363011   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00366541   1/1  ----------------------------------------------------------------------
00483651   1/1  ----------------------------------------------------------------------
00482001   1/1  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00447051   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00469721   1/1  ----------------------------------------------------------------------
00467611   1/1  ----------------------------------------------------------------------
00496791   1/1  ----------------------------------------------------------------------
00472711   1/1  ----------------------------------------------------------------------
00384681   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00419401   1/1  ----------------------------------------------------------------------
00406191   1/1  ----------------------------------------------------------------------
00469731   1/1  ----------------------------------------------------------------------
00463441   1/1  ----------------------------------------------------------------------
00360161   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00481081   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00423661   1/1  ----------------------------------------------------------------------
00382851   1/1  ----------------------------------------------------------------------
00529641   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------