[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF08549.1


[Show Plain Result]

## Summary of Sequence Search
   1::341
  82::193  5.8e-05 20.4% 0046055 00460551 1/1   uclease H-like                          
   1::341


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIKELPAGVAKVLKRLHHPLDVILLCVRWYVAYSLSLRDLEEMMAERGLAVDHSMVHRWVIKLLPLFEKA
00460551   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FRRHKRSVSKSWRMDETYLKVRGKWAYLYRAVDKAGNTIDFLLCARRDKVAARRYFEKAIGQNGAPDTVA
00460551   1/1  -----------gplfratrpnelwhiDitplptsggklyllvviDdfsryvvayplksktaelvakalkr


                         +         -         -         -         -         *         -:210
query           IDKSAANLAALHAVNAHRETPIRIRQRKYLNNIVEQDHRAIKRRARPMLGFKNFRCARILIGGIETMHMI
00460551   1/1  iiarfgvpkvihsDnGseftskafqellkelgikhsfsrpy....tpqqngvv-----------------


                         -         -         -         +         -         -         -:280
query           AKGRCGDPKAFACPPRSNSIPWFHRPAHSSPPASTNRPYRDRTKGAGAPAFGIQTPFDSSRGSLLLQWQA
00460551   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RLMIFDALSPTSRFHSVPEAMHLGKVVVDRGFRRPQSSLRVDTASYRINLAGERHVSRTHQ---------
00460551   1/1  ----------------------------------------------------------------------