[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF08608.1


[Show Plain Result]

## Summary of Sequence Search
   1::405
   1::405   8e-139 42.9% 0042642 00426421 1/1   ransferase family III (CaiB/BaiF)       
   2::405 2.1e-135 43.0% 0042164 00421641 1/1   ransferase family III (CaiB/BaiF)       
   1::405   5e-132 43.9% 0050996 00509961 1/1   ransferase family III (CaiB/BaiF)       
   2::396 9.1e-115 44.9% 0050868 00508681 1/1   ransferase family III (CaiB/BaiF)       
   1::405


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSAILQGIKVLDLTRVVAGPWATQNLADMGATVYKIEKPGDGDDTRRMGPFLTDGDGNVTNDSAFFLCCN
00426421   1/1  mtgpLaGlrVldlsrvlaGPfagmlLadlGAeVikverpgggdltrglgppllgg......lslyfllln
00421641   1/1  -lgpLaGirVldlsrvlaGPfagmlLAdlGAeVikverpgrgdptrrlgppllggl......slyfllln
00509961   1/1  lllsmlgpLaGlrVldlsrvlaGPfagmlLAdlGAeVikveppglgdllralgp..............yf
00508681   1/1  -agpLaglrVldlsrvlagPlagmlLadlGAeVikveppggdd...................salfllln


                         -         -         *         -         -         -         -:140
query           RGKQSVTVDISQPEGAELVRQLASHCDVVVENYKAGSLKKYGLDYESIRALRPDIIYCSVTGFGPDGPYA
00426421   1/1  rgKrsvaLDlkspegrelllrLvadADvlvenfrpgvlerlglgyealralnPrlvyvsisgfgqtgpya
00421641   1/1  rgKrsvaLDlkspegrelllrLvadADVlvenfrpgvlerlglgyealralnPrlvyvsisgfgqtGpya
00509961   1/1  lalnrgKrsvalDlkspegrelllrLvadADvlvenfrpgvlerlglgyealralnPrLvyvsisgfGqd
00508681   1/1  rgKrsvalDlkspegrellleLvadaDvlvenfrpgvlerlglgyealralnPrliyvsisgfGqdgpya


                         +         -         -         -         -         *         -:210
query           PRPAYDFILQGMAGLMSTCGQPDGTPGAAPMRTAIPLTDILTGLYASVALMGALYHRQATGEGQFIDAAM
00426421   1/1  drpgyDllvqAlsGllsltgrpdg....ppvpvgvlvadlaagllaalgilaallarertgkgqvvdvsl
00421641   1/1  drpgyDllvqAlsGllsltgrpdg....pplppgvlvadlaagllaaigilaallarertgkgqvvdvsl
00509961   1/1  gpeeyadrpgyDllvqAlsGllsltgrpdg.....PvrpgvlvadlaagllaalgilaAllerertgrgq
00508681   1/1  drpgydllvqalsGllsltgrpdg....pPvrpgvlvadllaGallaalgilaAllerertgkgqvvdvs


                         -         -         -         +         -         -         -:280
query           IDAAVAANGHLALGYHMTGKVPQRAGNSNPVASPSEVFACLDGHVIIAAGNNGQFAALCRVIGCASLIED
00426421   1/1  ldaalallslllasldglskldllellalllyllggavpprlgnalpgiaplldllyglyetadgwvala
00421641   1/1  ldaalallslllalldglslldllvllellelrlllsvdllalyllggvvpprlgnalpgiaplldllyg
00509961   1/1  vvdvslldaalallalllllylagglvperlgnalhpliapygvyrtadgwvalaalndkfwarlcealg
00508681   1/1  lldaalallslllllylagglvperlgnllpgiaplygvyetkdgryiaiaalndkfwarlcealglpdl


                         -         *         -         -         -         -         +:350
query           PRFLQNMDRVRNRPVLRETLGERLLNWRLADLIQALEGAGVPCGPINDIDDVFDDPQVRHRELLVRLPHG
00426421   1/1  alndgfwarlcealglpellddprfatnalrlanreelrallaaafatrtaaellallaaagvpaapvlt
00421641   1/1  lyetaDgwvalaalndkfwarllealglpeladdprfatnalrlanreelrallaaafatrtaaellall
00509961   1/1  lpeladdprfatnaarvllldlanrdelrallaaafatrtaaewlelleaagvpaapvlslaelladpql
00508681   1/1  addprf.....rvenrdellellaeafatrtaaewlelleeagvpaapvlsleelledpqllarglfvev


                         -         -         -         -         *         -         -:420
query           SGVEAPTLRSPLRFSATPVTMTAPPQLGQHTEAALRSELGMSAADVEAFRERGVI---------------
00426421   1/1  leevladpqlrargllvevdhpllggvllpgppvrlsgtpaavrpaPllGehtee---------------
00421641   1/1  aaagvpaapvltleevladpqlrargllvevdhpalggvlvpgppvrlsgtpaav---------------
00509961   1/1  rargllvevdhpdgggvllpgppvrlsgtplavrrpaPllGehtdevlae.lgls---------------
00508681   1/1  d...g.evrlvgap.rfsgtplsirraPllGehtdeilael.....------------------------