[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF08678.1


[Show Plain Result]

## Summary of Sequence Search
   1::121
   7::112  5.5e-24 34.0% 0053261 00532611 1/1   ed helix" DNA-binding domain            
   3::103  5.6e-24 31.7% 0049944 00499441 1/1   ed helix" DNA-binding domain            
   6::97   1.8e-22 34.8% 0049777 00497771 1/1   ed helix" DNA-binding domain            
   4::97     1e-19 36.2% 0043095 00430951 1/1   ed helix" DNA-binding domain            
   3::96   2.7e-19 34.0% 0043669 00436691 1/1   ed helix" DNA-binding domain            
   1::81   1.9e-17 39.2% 0051170 00511701 1/1   ed helix" DNA-binding domain            
   6::101  2.4e-17 32.3% 0044258 00442581 1/1   ed helix" DNA-binding domain            
   3::105  1.4e-16 32.4% 0049384 00493841 1/1   ed helix" DNA-binding domain            
   2::104  1.8e-15 31.1% 0052364 00523641 1/1   ed helix" DNA-binding domain            
   3::106  3.1e-12 24.0% 0051521 00515211 1/1   ed helix" DNA-binding domain            
  20::106  1.4e-10 27.6% 0052644 00526441 1/1   ed helix" DNA-binding domain            
   2::108  2.6e-10 27.4% 0052579 00525791 1/1   ed helix" DNA-binding domain            
  20::107  4.6e-10 30.7% 0040266 00402661 1/1   ed helix" DNA-binding domain            
  23::84   7.2e-10 43.5% 0053027 00530271 1/1   ed helix" DNA-binding domain            
  12::105  7.4e-10 27.7% 0052506 00525061 1/1   ed helix" DNA-binding domain            
  16::104  1.7e-09 27.0% 0043935 00439351 1/1   ed helix" DNA-binding domain            
  15::104  2.4e-09 27.8% 0051024 00510241 1/1   ed helix" DNA-binding domain            
  20::117  5.5e-09 29.2% 0053037 00530371 1/1   ed helix" DNA-binding domain            
   1::105  3.8e-08 24.8% 0051444 00514441 1/1   ed helix" DNA-binding domain            
   2::73   1.1e-07 26.4% 0052755 00527551 1/1   ed helix" DNA-binding domain            
  20::105  1.2e-07 29.1% 0047585 00475851 1/1   ed helix" DNA-binding domain            
  20::105  1.4e-07 27.9% 0052640 00526401 1/1   ed helix" DNA-binding domain            
  20::107  2.5e-07 29.9% 0043164 00431641 1/1   ed helix" DNA-binding domain            
  11::73   2.9e-07 41.3% 0045862 00458621 1/1   ed helix" DNA-binding domain            
  19::105  3.2e-07 28.7% 0049308 00493081 1/1   ed helix" DNA-binding domain            
  12::89     4e-07 25.6% 0048703 00487031 1/1   ed helix" DNA-binding domain            
  16::78   4.6e-07 33.3% 0045968 00459681 1/1   ed helix" DNA-binding domain            
   4::105  6.4e-07 26.5% 0040586 00405861 1/1   ed helix" DNA-binding domain            
  20::105  9.1e-07 27.9% 0052641 00526411 1/1   ed helix" DNA-binding domain            
   6::105    2e-06 29.0% 0052514 00525141 1/1   ed helix" DNA-binding domain            
  14::110    3e-06 32.0% 0041905 00419051 1/1   ed helix" DNA-binding domain            
  19::105  5.1e-06 28.7% 0040517 00405171 1/1   ed helix" DNA-binding domain            
  21::69   9.2e-06 36.7% 0051302 00513021 1/1   ed helix" DNA-binding domain            
   4::105  1.5e-05 27.5% 0051708 00517081 1/1   ed helix" DNA-binding domain            
   8::71   1.5e-05 34.4% 0043062 00430621 1/1   ed helix" DNA-binding domain            
   5::105  2.2e-05 28.3% 0051528 00515281 1/1   ed helix" DNA-binding domain            
  15::76   3.1e-05 33.9% 0039384 00393841 1/1   ed helix" DNA-binding domain            
  14::74   3.3e-05 36.1% 0048605 00486051 1/1   ed helix" DNA-binding domain            
  25::105  4.3e-05 28.4% 0042156 00421561 1/1   ed helix" DNA-binding domain            
  13::73   4.4e-05 32.8% 0044139 00441391 1/1   ed helix" DNA-binding domain            
   4::69   5.5e-05 28.8% 0048861 00488611 1/1   ed helix" DNA-binding domain            
   1::105  9.2e-05 27.6% 0052801 00528011 1/1   ed helix" DNA-binding domain            
  26::108  0.00011 30.5% 0048695 00486951 1/1   ed helix" DNA-binding domain            
  17::71   0.00015 38.2% 0051507 00515071 1/1   ed helix" DNA-binding domain            
  18::65   0.00045 41.7% 0047283 00472831 1/1   ed helix" DNA-binding domain            
   1::121


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLNYSDPHVALDATFQALADTTRRTMLAQLARGPLSVTELARPLAMSLPAVMQHLSVLEQAGLVRTEKVG
00532611   1/1  ------mmedlarllkaLgdptrlrILrlLlegpltvseLaeelgisqstvsrhLkkLeeaGlverrrep
00499441   1/1  --mldemleelaelfkaLadptRlrILelLaegeltvseLaellglsqstvsrHLkkLeeaGlverrreg
00497771   1/1  -----llllllllllllldeedleelaellkaLadptRlrIlrlLaeegeltvgeLaellglsqstvshh
00430951   1/1  ---dellleelaellkaladptrlrilrlLaegelsvgelaealglsqstvsrhLkvLeeaglvkrrreg
00436691   1/1  --mllllllelleelaellkaladptrlrilrlLaegelsvgeLaealglsqstvsrhLkvLeeaglver
00511701   1/1  lllllllllllllleelleelarllkaladptRlrILrlLa.gelsvselaellglsqstvshhLkvL.e
00442581   1/1  -----mdrlllalllkalldptrlliLllLaedgeltvseLaellglspstlsrhLkrLeeaGlverrrd
00493841   1/1  --llrllleelaellkalgldptrlriLllLlenggltvseLaeelglsrstvsrrlkrLeeaGlverer
00523641   1/1  -raaraliellaellkalgldptrlriLllLlengepltvseLaellglskstvsrhlkkLeeaGlverr
00515211   1/1  --lllellcpvalaldllgdkwrlliLrlllegplrfseLarllpgisqgtltrrLkrLeedGlverevy
00526441   1/1  -------------------lslsleslllldlldlllldlldmedpdldelelellfllrrlaralrrll
00525791   1/1  -ldlkeelcpvaraldllgdkwrlliLrlllegplrfgeLarrlgiskstLsrrLkrLeeaGlvervype
00402661   1/1  -------------------iflllraarllikllgellkrlglsptrlriLalLaesdgpltvselaeel
00530271   1/1  ----------------------rarilllLlegplsvaeLaealglsqstvsnhLkvLrdaGlvvaekeg
00525061   1/1  -----------rivlelllgklrlliLalLaegplhgyeLakrleelslgllpgispgtlypaLkrLeed
00439351   1/1  ---------------glgltplqlliLllLaegpgltvyelaerlggllslspgtvyrllkrLekeGlve
00510241   1/1  --------------kelllgllqlliLalLaegplygyelaklleellggllgisegtlypaLkrLekkg
00530371   1/1  -------------------tpaqfrvLlaLaelggpltvseLaerlglskstvtrllkrLekkGlverer
00514441   1/1  lmllldlllllcpvaraldllgdkwrlliLrllldgplrfseLarrlpgisqstlsrrLkrLeedGlver
00527551   1/1  -ldllellcpvalaldllggkwklliLrlllngplrfseLaralpgisqktlsrrLkeLeedglverrvy
00475851   1/1  -------------------tpaqflvLlaLaenggltvseLaerlglskstvtrlldrLekkGlvererd
00526401   1/1  -------------------tpaqflvLlaLaelnggltqseLaerlglskstvtrlldrLekkGlverer
00431641   1/1  -------------------srtrlliLllLlealegelsftelaealglsqstvsrhlkkLeelglvere
00458621   1/1  ----------lleltelledylklillllledgplsvseLaerlgvspptvsralkrLeedGlvererdg
00493081   1/1  ------------------dlldlelqllfllrrlaralrrlldellkelgltpaqfrvLlaLaenggltv
00487031   1/1  -----------llkllklseleleilrlLwklgpltvkeiaeeleeelglspstvstlLkrLeekglver
00459681   1/1  ---------------lllderrlkillllledgrlsveeLaeelgvSrstvrrhlkrLeeaGliiesvpg
00405861   1/1  ---mdeldeellfllrralrlllrlllldellkelgltlaqfliLllLaenggltvseLaerlglskstl
00526411   1/1  -------------------tlaqfrvLllLaenggltvseLaerlglskstltrlldrLekkGlvererd
00525141   1/1  -----dldlellfllrrlarallrlldellkelgltpaqflvLlaLaelggltvseLaerlglskstvtr
00419051   1/1  -------------kelgltplelevllvLwekgpltvkelaeelgeeldlspstvttllkrLekkGlver
00405171   1/1  ------------------eqllfllrraarlllrlldellkelgltltqfrvLllLaenggltvseLaer
00513021   1/1  --------------------slrlliLglLaegpmhgyelakeleerlggfwgispgtlypaLkrLeee-
00517081   1/1  ---deellfllrrlarallrlldellkelgltpaqflvLlaLaenggltvseLaerlgiskstvtrllkr
00430621   1/1  -------lllglvlsmalrvaielgildlLadgpltvaeLAerlglspsalsrlLrlLaslglveedgeg
00515281   1/1  ----mdlelellfllrrlarallrlldellkelgltpaqflvLlaLaenggltvseLaerlglskstltr
00393841   1/1  --------------llmllderlllillllleggepvsveeLaeelgvsrstvrrdlalLeelglvirrr
00486051   1/1  -------------ltesledylllilllllengpvsvselaerlgvspstvtrlvkrLeekglverepdg
00421561   1/1  ------------------------llLaeaeeggltvkelaeklglskstvtrllkrLekkglvervrsp
00441391   1/1  ------------vlsaalkaavelgildlLadgpltvaeLaaalgldpsllsrlLralvalglveededg
00488611   1/1  ---lllnddlvlevllellgdealeilelllesggevtdeelAellgislnvVRriLylLeeaglveyr-
00528011   1/1  mdldlpdllllelellfllrrlaralrrlldellkelgltpaqfrvLlaLaenggltvseLaerlglsks
00486951   1/1  -------------------------vLlaLaelggglltvseLaerlglskstvtrlldrLekkglvere
00515071   1/1  ----------------llldlnqllvlrllrengplsraeLarllglspatvtrivdeLeeaglveevgd
00472831   1/1  -----------------ldeleleilllllengplsiselaerlglskstvsrhlkkLeeaglie-----


                         -         -         *         -         -         -         -:140
query           RVRTCTMAPKALSEAEQWINARRAEWEGHFDRLGEYLETMKKEAASDGNGN-------------------
00532611   1/1  edrggrrvyYrltekglallldllaelaealleeleellgel----------------------------
00499441   1/1  rdrgrpekyYrltdeglallpdlleellvdlle-------------------------------------
00497771   1/1  LkvLeeaGlverrregrrvyyrlndeg-------------------------------------------
00430951   1/1  rrvyyrltdeglaellelllellelie-------------------------------------------
00436691   1/1  rrdgrrvyyrltdeglaallelllel--------------------------------------------
00511701   1/1  aglverrregr-----------------------------------------------------------
00442581   1/1  pedgrrvyysltekgrelleallelleelle---------------------------------------
00493841   1/1  apldgrkvgysltekg.elleelleallelleell-----------------------------------
00523641   1/1  rsegdgrkvyysltekgrelleellelllellee------------------------------------
00515211   1/1  pedprrveysLTekGrallpvllallewgeehllei----------------------------------
00526441   1/1  dellkelgltpaqfrvLlaLaenggggyltvseLae----------------------------------
00525791   1/1  dprrveYrLTekGrallpvllalae.wgeehlaellea--------------------------------
00402661   1/1  glskstvsralkrLeelGlvrrerspgdrrrvyyslt---------------------------------
00530271   1/1  rrvlyeltdsllas--------------------------------------------------------
00525061   1/1  GlverevepsdgprrkyYrlTeaGrelleellall-----------------------------------
00439351   1/1  rrrdrrrkyyslTekGkelleellelleellell------------------------------------
00510241   1/1  lveryleesegdrrrkyyrlTekGrelleellee------------------------------------
00530371   1/1  dpeDrRrvllslTekGrelleellelleelleellagvlseeeleal-----------------------
00514441   1/1  rvypedprrveysLTekGrellpvllallewgeeh-----------------------------------
00527551   1/1  ped-------------------------------------------------------------------
00475851   1/1  peDrRavllslTekGrelleellellleelleell-----------------------------------
00526401   1/1  dpeDrRavllsLTekGrelleellalllelleell-----------------------------------
00431641   1/1  gk.yysLTekGeellellrellelleellelllelle---------------------------------
00458621   1/1  gdr-------------------------------------------------------------------
00493081   1/1  seLaerlglskstvtrlldrLekkGlvererdpeD-----------------------------------
00487031   1/1  ekegrayiYsalvskeeyl---------------------------------------------------
00459681   1/1  kgyrllld--------------------------------------------------------------
00405861   1/1  trllkrLekkglvererdpeDrRvvllsLTekGre-----------------------------------
00526411   1/1  peDrRrvllsLTekGrelleellalllelleella-----------------------------------
00525141   1/1  lldrLekkGlvererdpeDrRvvllslTekGrell-----------------------------------
00419051   1/1  ekdgrrvvyysltekgeellellkelleelfegllellla------------------------------
00405171   1/1  lglsrstvtrllkrLeekGlvererdpedrRavll-----------------------------------
00513021   1/1  ----------------------------------------------------------------------
00517081   1/1  LekkGlverepdpeDrRrvllslTekGrelleell-----------------------------------
00430621   1/1  r---------------------------------------------------------------------
00515281   1/1  llkrLekkGlvererdpeDrRvvllsLTekGrell-----------------------------------
00393841   1/1  gggyrl----------------------------------------------------------------
00486051   1/1  gvlL------------------------------------------------------------------
00421561   1/1  eDrRvvllsLTekgrelleellelleellkellsg-----------------------------------
00441391   1/1  rya-------------------------------------------------------------------
00488611   1/1  ----------------------------------------------------------------------
00528011   1/1  tvtrlldrLekkGlvererdpeDrRvvllsLTekG-----------------------------------
00486951   1/1  rdpeDrRavllslTekGrelleellalleellee.leq--------------------------------
00515071   1/1  p---------------------------------------------------------------------
00472831   1/1  ----------------------------------------------------------------------