[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF08687.1


[Show Plain Result]

## Summary of Sequence Search
   1::564
  11::299  5.9e-86 35.3% 0048843 00488431 1/1   hoenolpyruvate/pyruvate domain          
   9::326  1.2e-80 34.4% 0037440 00374401 1/1   hoenolpyruvate/pyruvate domain          
  10::298  5.3e-80 31.8% 0047364 00473641 1/1   hoenolpyruvate/pyruvate domain          
   7::340  3.8e-79 34.3% 0046386 00463861 1/1   hoenolpyruvate/pyruvate domain          
  10::299  3.7e-78 34.4% 0041093 00410931 1/1   hoenolpyruvate/pyruvate domain          
  11::294  5.2e-78 36.8% 0049923 00499231 1/1   hoenolpyruvate/pyruvate domain          
 302::543  8.7e-33 32.3% 0047707 00477071 1/1   otide-diphospho-sugar transferases      
 303::558  9.2e-30 28.4% 0044168 00441681 1/1   otide-diphospho-sugar transferases      
 303::550  2.2e-27 27.4% 0038743 00387431 1/1   otide-diphospho-sugar transferases      
 307::546  9.5e-27 30.0% 0038427 00384271 1/1   otide-diphospho-sugar transferases      
 304::550  6.1e-26 30.7% 0038005 00380051 1/1   otide-diphospho-sugar transferases      
 302::548  3.3e-25 31.9% 0044743 00447431 1/1   otide-diphospho-sugar transferases      
 305::547  4.8e-25 28.8% 0040693 00406931 1/1   otide-diphospho-sugar transferases      
 307::547    2e-24 27.9% 0051364 00513641 1/1   otide-diphospho-sugar transferases      
 306::550  5.4e-24 31.9% 0048137 00481371 1/1   otide-diphospho-sugar transferases      
 304::543  6.2e-24 26.2% 0050178 00501781 1/1   otide-diphospho-sugar transferases      
 304::549  2.5e-23 28.2% 0046877 00468771 1/1   otide-diphospho-sugar transferases      
 302::543    3e-23 30.3% 0038881 00388811 1/1   otide-diphospho-sugar transferases      
 302::551  7.7e-23 29.9% 0050266 00502661 1/1   otide-diphospho-sugar transferases      
 305::543  5.5e-22 31.1% 0047373 00473731 1/1   otide-diphospho-sugar transferases      
 304::554  8.3e-22 25.9% 0050195 00501951 1/1   otide-diphospho-sugar transferases      
 302::549  1.3e-19 28.8% 0050387 00503871 1/1   otide-diphospho-sugar transferases      
 303::544    8e-19 25.8% 0046466 00464661 1/1   otide-diphospho-sugar transferases      
 305::543  4.2e-18 30.8% 0053095 00530951 1/1   otide-diphospho-sugar transferases      
 304::549  2.2e-16 23.2% 0050366 00503661 1/1   otide-diphospho-sugar transferases      
 307::543  2.4e-16 28.4% 0038462 00384621 1/1   otide-diphospho-sugar transferases      
 303::543  8.6e-16 29.0% 0049057 00490571 1/1   otide-diphospho-sugar transferases      
   9::133  1.2e-13 25.0% 0042073 00420731 1/1   hoenolpyruvate/pyruvate domain          
 307::415  2.5e-11 31.1% 0046659 00466591 1/2   otide-diphospho-sugar transferases      
 515::548      9.2 29.4% 0046659 00466592 2/2   otide-diphospho-sugar transferases      
   1::564


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNAHDPNLLATSRSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASW
00488431   1/1  ----------lklaellrellesgdplvlpgaldalsArlaeeagfeaiylsgaavaaslglpDlglltl
00374401   1/1  --------leeellleseveeveellssprlkgikrpysaedvvklrgslllsltlaeklakllrellks
00473641   1/1  ---------elleeeveevekllesprwkgikrpytaedvvklrgslkieltlasllaeklaalrelles
00463861   1/1  ------dllegeealleeevaevekwwssprwkgikrpytaedvvklrgslkleyasstlakklakllre
00410931   1/1  ---------leklakllrellesgellvlpgaldalsarlaekaGfeaiylsGagvaasvlglpDlgllt
00499231   1/1  ----------kklakllrallesgeplvlpgaydalsArlaeeagfdaiylsGaavaasllGlpDlgllt
00477071   1/1  ----------------------------------------------------------------------
00441681   1/1  ----------------------------------------------------------------------
00387431   1/1  ----------------------------------------------------------------------
00384271   1/1  ----------------------------------------------------------------------
00380051   1/1  ----------------------------------------------------------------------
00447431   1/1  ----------------------------------------------------------------------
00406931   1/1  ----------------------------------------------------------------------
00513641   1/1  ----------------------------------------------------------------------
00481371   1/1  ----------------------------------------------------------------------
00501781   1/1  ----------------------------------------------------------------------
00468771   1/1  ----------------------------------------------------------------------
00388811   1/1  ----------------------------------------------------------------------
00502661   1/1  ----------------------------------------------------------------------
00473731   1/1  ----------------------------------------------------------------------
00501951   1/1  ----------------------------------------------------------------------
00503871   1/1  ----------------------------------------------------------------------
00464661   1/1  ----------------------------------------------------------------------
00530951   1/1  ----------------------------------------------------------------------
00503661   1/1  ----------------------------------------------------------------------
00384621   1/1  ----------------------------------------------------------------------
00490571   1/1  ----------------------------------------------------------------------
00420731   1/1  --------lkrltladlrklkeegeklvmltaydalsArlaeeagvdvllvGdslgmvvlGlpdtllvtl
00466591   1/2  ----------------------------------------------------------------------
00466592   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQPLAD
00488431   1/1  devlelvrrivravdlPviaDadtGygdalnvartvrllieaGvagihiEDqllpKrcghlggkvqvlvs
00374401   1/1  gdllvlpgaldalsArlaekaGfeaiylsGaavaasansvglglpDlgllpldevlelvrriaravdrad
00473641   1/1  ggllvlpgaldalsArlaekaGfeaiylsGwavaasaslaglglpDlgllpldevlalvrriaravdlad
00463861   1/1  llasgkplvlpgaldalsarlaek.gfealylsGwavaasllstgeglPDlgllpltevlnlveriarav
00410931   1/1  ldevlelvrriaravdlPlivDadtGfGgsalnvartvkllieaGaagvhiEDqvgpkkcGhlggk..el
00499231   1/1  ldevlalvrriaratdlPviaDadtGyggsplnvartvrllieaGaagvhiEDqvgpkkcghlgg..kpl
00477071   1/1  ----------------------------------------------------------------------
00441681   1/1  ----------------------------------------------------------------------
00387431   1/1  ----------------------------------------------------------------------
00384271   1/1  ----------------------------------------------------------------------
00380051   1/1  ----------------------------------------------------------------------
00447431   1/1  ----------------------------------------------------------------------
00406931   1/1  ----------------------------------------------------------------------
00513641   1/1  ----------------------------------------------------------------------
00481371   1/1  ----------------------------------------------------------------------
00501781   1/1  ----------------------------------------------------------------------
00468771   1/1  ----------------------------------------------------------------------
00388811   1/1  ----------------------------------------------------------------------
00502661   1/1  ----------------------------------------------------------------------
00473731   1/1  ----------------------------------------------------------------------
00501951   1/1  ----------------------------------------------------------------------
00503871   1/1  ----------------------------------------------------------------------
00464661   1/1  ----------------------------------------------------------------------
00530951   1/1  ----------------------------------------------------------------------
00503661   1/1  ----------------------------------------------------------------------
00384621   1/1  ----------------------------------------------------------------------
00490571   1/1  ----------------------------------------------------------------------
00420731   1/1  demlyhtravvraadlalvv.aDlpfgsyeaslelavanavrllkeagaaavkleggaelaet-------
00466591   1/2  ----------------------------------------------------------------------
00466592   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           IDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHSKLSKADEIVTFAR
00488431   1/1  leeaveriraaraaragvdfviiARtdaylaglgldeaieralayaeaGAdaifveglypdleeirafae
00374401   1/1  rkqlleakddlldyllPviaDadtGfGgalnvarlvkllieaGaagvhiEDqvagpKkcGhlggk..vlv
00473641   1/1  rkqllellerkldplvdyllPviaDadtGfGgalnvartvkllieaGaagvhiEDqvapeKkcGhlgg..
00463861   1/1  dladrkqleerlslldeeraltpyvdyllPiiaDaDtGyGgalnvarlvkllieaGaagihiEDqvlplK
00410931   1/1  vpteeavekikaarlavlgvdlliiARtdalllg.gleeaieRalayaeaGAdlifieal.pdleeiraf
00499231   1/1  vpleeaveriraardarlgvdfliiaRtdalllg.gleeaieRalayaeaGAdaifvegl.pdleeiaaf
00477071   1/1  ----------------------------------------------------------------------
00441681   1/1  ----------------------------------------------------------------------
00387431   1/1  ----------------------------------------------------------------------
00384271   1/1  ----------------------------------------------------------------------
00380051   1/1  ----------------------------------------------------------------------
00447431   1/1  ----------------------------------------------------------------------
00406931   1/1  ----------------------------------------------------------------------
00513641   1/1  ----------------------------------------------------------------------
00481371   1/1  ----------------------------------------------------------------------
00501781   1/1  ----------------------------------------------------------------------
00468771   1/1  ----------------------------------------------------------------------
00388811   1/1  ----------------------------------------------------------------------
00502661   1/1  ----------------------------------------------------------------------
00473731   1/1  ----------------------------------------------------------------------
00501951   1/1  ----------------------------------------------------------------------
00503871   1/1  ----------------------------------------------------------------------
00464661   1/1  ----------------------------------------------------------------------
00530951   1/1  ----------------------------------------------------------------------
00503661   1/1  ----------------------------------------------------------------------
00384621   1/1  ----------------------------------------------------------------------
00490571   1/1  ----------------------------------------------------------------------
00420731   1/1  ----------------------------------------------------------------------
00466591   1/2  ----------------------------------------------------------------------
00466592   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EWAGRAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAASSMQAVAREIHDSQTLVNVEDRIATVNE
00488431   1/1  avdlplllnlvpgftpllsldeLaelGvrrviyglallraaakalldlarelledgtlkevlddlqsfee
00374401   1/1  pteeaverikAarlaadvlgvdlviiARTDalaaglltsdidvrdhefilgertreGlyrlkegleeaie
00473641   1/1  kvlvpteeavariraarlaadelgvdfviiARTDalaaglltsdiderdhefilgertreGlyrlkegld
00463861   1/1  kcGhlggk..vlvpteefvariraarlaadelgvdfviiARTDalaag.gldeaidradayaeaGAdaif
00410931   1/1  aeavkaplpvnllaygaspl.fsldeLaelGvrrviyglallraaakalldlarelledgtlayvedvll
00499231   1/1  aeavdlplpvnmlpggaspllslqelaelGvlrviyglallraaalalleaarelledgtlaevedvllp
00477071   1/1  ----------------------------------------------------------------------
00441681   1/1  ----------------------------------------------------------------------
00387431   1/1  ----------------------------------------------------------------------
00384271   1/1  ----------------------------------------------------------------------
00380051   1/1  ----------------------------------------------------------------------
00447431   1/1  ----------------------------------------------------------------------
00406931   1/1  ----------------------------------------------------------------------
00513641   1/1  ----------------------------------------------------------------------
00481371   1/1  ----------------------------------------------------------------------
00501781   1/1  ----------------------------------------------------------------------
00468771   1/1  ----------------------------------------------------------------------
00388811   1/1  ----------------------------------------------------------------------
00502661   1/1  ----------------------------------------------------------------------
00473731   1/1  ----------------------------------------------------------------------
00501951   1/1  ----------------------------------------------------------------------
00503871   1/1  ----------------------------------------------------------------------
00464661   1/1  ----------------------------------------------------------------------
00530951   1/1  ----------------------------------------------------------------------
00503661   1/1  ----------------------------------------------------------------------
00384621   1/1  ----------------------------------------------------------------------
00490571   1/1  ----------------------------------------------------------------------
00420731   1/1  ----------------------------------------------------------------------
00466591   1/2  ----------------------------------------------------------------------
00466592   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IFRLQDADEYSAAEKIYLTGGQAPSSAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGI
00488431   1/1  llellgldellelgedyld---------------------------------------------------
00374401   1/1  Ralayae.gAdlifiealtpdleeikafaeav..kapllanllayg------------------------
00473641   1/1  eaieRalayae.gAdlif----------------------------------------------------
00463861   1/1  veglesleeiaelvaalglellaledewpllanlvlvgetpllslee.laelgvsiviyg----------
00410931   1/1  srkelleligllelqkllg---------------------------------------------------
00499231   1/1  lkellelvgllell--------------------------------------------------------
00477071   1/1  ---------------------mmkmkavIlAaGlGtRlgplTsdlpKpllpvggkplieytleallaagi
00441681   1/1  ----------------------mkmkavILAgGlGtRlgplTsdlpKpllplggkPliehvlealaaagi
00387431   1/1  ----------------------mkmkavILAaGlGtRlgplt...pKpllpiagkpllehvlerllaagi
00384271   1/1  --------------------------mimkavILAaGlGtRLrpltralPKqllpvggkPliqytlerla
00380051   1/1  -----------------------kmkavILAaGlGtRlgplt...pKpllpiggkpllehvleallaagi
00447431   1/1  ---------------------mmkmkavilAAGlGtRlgp...dlPKqllplggkpllehvleallaagl
00406931   1/1  ------------------------lkimkAvILAGGlGtRLrPlTralpKpllpvagkPlieytlerlaa
00513641   1/1  --------------------------lllllllmmkvmkavILAGGlGtRLrPlTkarPKpllpvggkyp
00481371   1/1  -------------------------hmkavIlAgGlGtRlgpltsdrpKpllplggkpliehtlerllaa
00501781   1/1  -----------------------kmkavIlAaggGtRlp......pKpllpiagkPliahvleallaagi
00468771   1/1  -----------------------mmkavILAGGlGtRlrPlTsalpKpllpvggkPlieytlerlaaagi
00388811   1/1  ---------------------mmkmkavilAAGlGtRmgp...dlpKpllplggkpllehvleallaagl
00502661   1/1  ---------------------mmkmkaiIlAaGkGtRlgp...dlpKqllplggkplleytleallaagl
00473731   1/1  ------------------------MmkmkavIlAgGlGtRlgplTsdrpKpllplggkpliqhtlerlla
00501951   1/1  -----------------------kmkavIlAgGlGtRlp......pKpllplggkpliehtlerllaagi
00503871   1/1  ---------------------lkmkmkaviLAgGsGtRlgp...dlpKqllplagkpllqhtlerllaag
00464661   1/1  ----------------------MmkikavIlAgGlGtRlgp....lpKpllpiggkpliehvlerll.ag
00530951   1/1  ------------------------dllrelleglllllklseldlesflalferlllellelldidlipl
00503661   1/1  -----------------------kmaaiilAAGkGtRmgs...dlpKqllklggkpllehtleallslgl
00384621   1/1  --------------------------MkvkavIlAaglGtRlp......pKpllpiaGkPliqhvieaal
00490571   1/1  ----------------------pmkvaAiIlArGggkrlp......pKnllplagkpliaytleallasg
00420731   1/1  ----------------------------------------------------------------------
00466591   1/2  --------------------------MkkkilaiIlAagkGtRlp......pKpllpiggkpliehvlea
00466592   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           NDITVVGGYKAEAIDAAGIKLVRNERHAATGELASLACAADSLETDTVVSYGDLMFRSYILRDLLETDAP
00488431   1/1  ----------------------------------------------------------------------
00374401   1/1  ----------------------------------------------------------------------
00473641   1/1  ----------------------------------------------------------------------
00463861   1/1  ----------------------------------------------------------------------
00410931   1/1  ----------------------------------------------------------------------
00499231   1/1  ----------------------------------------------------------------------
00477071   1/1  deivvvtgykaelieellgdygvkivyvlqpeglgtagavllaldll.ddvlvllgDvpllldlleahle
00441681   1/1  deivvvtgykaelieellgdgsellsdllldlklellellrllleglkityvlqgeplgtagavllaldl
00387431   1/1  deivvvtgyddelieellgdgnvtyvlqgep..lgtagavllalellgddepvlvllgDvplvtpadler
00384271   1/1  aagideivvvtgeylaelieellgdgselglkivyvvepeplgtagalllaldllgddpfvlvlngDili
00380051   1/1  deivvvtgykaeaieellglkvtyvvqpeplgtagavllaldalgddddpvlvllgDvplitdedldell
00447431   1/1  ideiivvvgykdelieellaklgirivlvegg..lgtggsvllalealgelllldepflvllgDaarplv
00406931   1/1  agieeivvvtgylalelieeylgdgselgvkityvlepeplgtagalllaldflgdepflvllgDhilld
00513641   1/1  lidytlsrlanagieeivvvtgykaesiedhlgdgselgldlklgglfvlllpanityvlepeplgtaga
00481371   1/1  gideivvvtgykaleliaellgdgselglevtyvlqgeplgtadavllaldalgddpvlvllgDhplidp
00501781   1/1  deivvvtgdeeiaealgdygvevvyvrqdealgtggavlaalelladgddpvlvllgDvPlitpelidrl
00468771   1/1  deivvvtgykdaelieeylgdgsllgvkityvlepeplgtagavllaldllgddpflvllgDhplidld.
00388811   1/1  ideivvvvgygdeaieelladlgilivlveggl..gtggsvllalealgdadpvlvldgDrplltpelle
00502661   1/1  ideivvvtgyedelieelllgldilivlqpgglgtagsvllalealgdldddpvlvldgDrpllspelld
00473731   1/1  agideivvvtgykarelieellgdgselglkvvyvlegeplgtadavllalealgddpvlvllgDrplid
00501951   1/1  deivvvtg.deeiaellsklgvevvyvvedealgtgplaavlaalellgddpvlvllgDhplldpedldr
00503871   1/1  lideivvvtgpedlelieellgdlgirvvlqpgg..lgtagavllalealgdgddlvlvldgDrplvdpe
00464661   1/1  ideiivvtgykaelikklglkviivlepeglgtadailaalkalgddpvlvllgDvplidpdlidkllea
00530951   1/1  lplelvvslldlellldleelglellnkmkaviLAGGlGtRLgp...slPKpllpvgngkpllehilerl
00503661   1/1  idiivvvgneedlvlladkvvvvveggl..gradsvlnalealdddivlvhdgdrplvspelidrlleal
00384621   1/1  aagiidivvv.gtddeeiedaldkygvevvltre.dalgtgdavlealellgddpvlvlqgDvPlitped
00490571   1/1  lideivVvtdddeiaevaekygaevvfrpaelagdgagtadsvlaalealedddivlvldadrpllsped
00420731   1/1  ----------------------------------------------------------------------
00466591   1/2  llksglideiivvtgdeeikeylkklgievilrikylqgdglgtadavllalkalgkdddpvlvl-----
00466592   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           FSVVVDSSESAPSNQSVRDFAWCSAADDRDLFGQKVLLRKISDTPAATDGEPHGRWIGLLNVRGEGRARL
00488431   1/1  ----------------------------------------------------------------------
00374401   1/1  ----------------------------------------------------------------------
00473641   1/1  ----------------------------------------------------------------------
00463861   1/1  ----------------------------------------------------------------------
00410931   1/1  ----------------------------------------------------------------------
00499231   1/1  ----------------------------------------------------------------------
00477071   1/1  sgalatvlvkdp.........tgygvvvlded.......grvlsfvekpd.....snlanagiyvfspev
00441681   1/1  lgddepvlvllgDvpl.dedlaelleahresgaavtvvpvp........dpsgygvvvldeg........
00387431   1/1  llealaetgatilvvpvedp....tgygvvvlddg........rvleivekpdllaeqtpsn.laniGiy
00384271   1/1  dvd.laelleaareegalatvllvpve..dptgygvvelded.......grvlsfvekpd..lagsnlan
00380051   1/1  eahlesgadatvlvvpvedpsgygvv.............vldedgrvlsfvekpdllaaqtpsnlantGi
00447431   1/1  spelldrllealeedgaavtlv........ppvygtikldedg.........rvveivekpd........
00406931   1/1  ld.lrelleahrekgalvtvllvpve..dpsgygvvelded.......grvlrfvEkpd..epgsnlana
00513641   1/1  lalaldllgdspdepflvllgDhlidvd.lselleahresgalatllvvpvpledptgyGvieldedgrv
00481371   1/1  dleelleahresgadvtvlvvpve.........................................dptgy
00501781   1/1  lealre.....sgadaavlvvpvedpegygvpnvvkvvldedgrvlgfvekpipltaerlllrrqdlpvs
00468771   1/1  laelleahresgalatllvvpved....ptgygvvelded.......grvlsfvEkpd..eprsnlanaG
00388811   1/1  rllealeehgalallav......pvgdygvvvldedg.......rvleivekpd.............lnl
00502661   1/1  rlleaakesgaavtv.........ppgygtikld..dg........rvleivekpd............ll
00473731   1/1  pdldelleahresgadvtvlvvpvedp......tgygvvevded.......grvlefvekpd....lpks
00501951   1/1  llealresgadatllvvpvpdpepltgygygvvvldedgr........vlrfvekpdafraelllyllns
00503871   1/1  lldrlieaaaeggavvlav...............pvgygvvvvdedgrvveivekpd.............
00464661   1/1  lkgadatvlvvp.........................................vrdptgygvfkldllg.
00530951   1/1  kalqkkagikveiiivtsyktaelikeylgdgsyfglkityvvqgkeplgtagalllaldflgddpflvl
00503661   1/1  keagaailalpvkdtlkygdi.....tldrdglw.........................aaqtpqlfrle
00384621   1/1  ldelleallesgadivvlvvevddpillalpgygvv........vldedgrvlyfvekpipyrrqdlaps
00490571   1/1  idrllealresgadgailvvpvs.................................dtlkrgvvldedgr
00420731   1/1  ----------------------------------------------------------------------
00466591   1/2  ----------------------------------------------------------------------
00466592   2/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           QKLLAELRQRPDFDSLDMPDLINALVEAGEKVEVRYVHGHWRGVNDLEDFRRAGDFAHTQTPYALGNNDG
00488431   1/1  ----------------------------------------------------------------------
00374401   1/1  ----------------------------------------------------------------------
00473641   1/1  ----------------------------------------------------------------------
00463861   1/1  ----------------------------------------------------------------------
00410931   1/1  ----------------------------------------------------------------------
00499231   1/1  ----------------------------------------------------------------------
00477071   1/1  fdllkelleellkpgargelyltdilaallekglkvvavlldgywldvgtped-----------------
00441681   1/1  rvlsfvekp...dresllanagiyvfspelldllle..........rgelyltdvlplllaag.kvya--
00387431   1/1  vfspevldallelllkpgargeleltdllsllleaglkvlavlgdgfwldvgtpedllla----------
00384271   1/1  sGiyvfdas....lldlleel.apsafgeleltdvlyallekglrvvavlgdgfaw--------------
00380051   1/1  yvfdpe...lldallellpsdgargelyltdvislllaaglkvlaveldgywldvgtped----------
00447431   1/1  .....lnlantGqyflsplllealea..ggeiyltdllslleaaglkvlavegdglwi------------
00406931   1/1  Giyvfspevldlleellps.....argelfltdvidylleegllkvyaypfdgywld-------------
00513641   1/1  lsfvEkpdletaeeylalglllllsllllepksnlansGiyvfspevlldlleelap-------------
00481371   1/1  gvvevdedgrvlsfvekpdlppsqlanaGiyvfrpdvldaleelapsalgeleltdiidl----------
00501781   1/1  ylinggiyafrpelllalle........gargeleltdvlellralaaggrva-----------------
00468771   1/1  iyvfspe...vl.dlleel.kpsargelfltdvidlllaegllkvyaypldgywldvgt-----------
00388811   1/1  antGqyflspalldalealaggelyltdllslleaaglrvlavegdgewldig-----------------
00502661   1/1  anqgpylfdaellleal.....rgelyltddlallekaglkvavvegdgewldvgtpedla---------
00473731   1/1  n.lantgiyvfnpgvlllllell..lsalgeleltdilrallaaglkvyavll-----------------
00501951   1/1  gifleatsdlanagiyvfspe....vlealenl.didtledlelaeillall.kggkvyavlld------
00503871   1/1  lnlantgqyflspllldalekaargeleltdilslllelglkvvvvpgdgfwldvgtpe-----------
00464661   1/1  .....kllsfvekp.....atdlasllalaglyvllvpglldllkdidtpedle----------------
00530951   1/1  PdGnGDiltdldlsklldfhlesgadatlvvnvdnlvpvadpsr.yGvveldg-----------------
00503661   1/1  llleal........egeyyltddasllealglkvalvegdeenikittpeDlalaeall-----------
00384621   1/1  ylinggiyvfrpeillallell.....pgaleeiellealrlla.aggrvlay-----------------
00490571   1/1  vlalvekplarartqdlfrlyllnggiyilk.daldealaleggkvva.lvlg-----------------
00420731   1/1  ----------------------------------------------------------------------
00466591   1/2  ----------------------------------------------------------------------
00466592   2/2  ------------------------alengkkvavvlgdglwldidtpedlelaekllk------------


                         -         -         -         *         -         -         -:630
query           ETAR------------------------------------------------------------------
00488431   1/1  ----------------------------------------------------------------------
00374401   1/1  ----------------------------------------------------------------------
00473641   1/1  ----------------------------------------------------------------------
00463861   1/1  ----------------------------------------------------------------------
00410931   1/1  ----------------------------------------------------------------------
00499231   1/1  ----------------------------------------------------------------------
00477071   1/1  ----------------------------------------------------------------------
00441681   1/1  ----------------------------------------------------------------------
00387431   1/1  ----------------------------------------------------------------------
00384271   1/1  ----------------------------------------------------------------------
00380051   1/1  ----------------------------------------------------------------------
00447431   1/1  ----------------------------------------------------------------------
00406931   1/1  ----------------------------------------------------------------------
00513641   1/1  ----------------------------------------------------------------------
00481371   1/1  ----------------------------------------------------------------------
00501781   1/1  ----------------------------------------------------------------------
00468771   1/1  ----------------------------------------------------------------------
00388811   1/1  ----------------------------------------------------------------------
00502661   1/1  ----------------------------------------------------------------------
00473731   1/1  ----------------------------------------------------------------------
00501951   1/1  ----------------------------------------------------------------------
00503871   1/1  ----------------------------------------------------------------------
00464661   1/1  ----------------------------------------------------------------------
00530951   1/1  ----------------------------------------------------------------------
00503661   1/1  ----------------------------------------------------------------------
00384621   1/1  ----------------------------------------------------------------------
00490571   1/1  ----------------------------------------------------------------------
00420731   1/1  ----------------------------------------------------------------------
00466591   1/2  ----------------------------------------------------------------------
00466592   2/2  ----------------------------------------------------------------------