[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF08803.1


[Show Plain Result]

## Summary of Sequence Search
   1::238
   1::232  1.7e-67 42.2% 0051568 00515681 1/1   )-binding Rossmann-fold domains         
   3::240  8.8e-65 40.7% 0049902 00499021 1/1   )-binding Rossmann-fold domains         
   3::235  6.2e-64 43.5% 0047681 00476811 1/1   )-binding Rossmann-fold domains         
   5::235  1.2e-63 42.4% 0045076 00450761 1/1   )-binding Rossmann-fold domains         
   3::235    2e-63 41.9% 0042131 00421311 1/1   )-binding Rossmann-fold domains         
   1::236  7.3e-63 40.7% 0050365 00503651 1/1   )-binding Rossmann-fold domains         
   3::236  9.6e-63 41.6% 0050967 00509671 1/1   )-binding Rossmann-fold domains         
   3::235  3.1e-62 42.6% 0047124 00471241 1/1   )-binding Rossmann-fold domains         
   5::235  4.6e-62 43.0% 0046592 00465921 1/1   )-binding Rossmann-fold domains         
   1::236    3e-61 41.9% 0050776 00507761 1/1   )-binding Rossmann-fold domains         
   3::235  4.1e-61 41.6% 0038342 00383421 1/1   )-binding Rossmann-fold domains         
   1::235  7.7e-61 42.2% 0051763 00517631 1/1   )-binding Rossmann-fold domains         
   2::232  8.7e-61 41.7% 0051511 00515111 1/1   )-binding Rossmann-fold domains         
   3::232  9.3e-61 41.4% 0037662 00376621 1/1   )-binding Rossmann-fold domains         
   4::235  1.1e-60 42.6% 0048361 00483611 1/1   )-binding Rossmann-fold domains         
   1::236  2.1e-60 42.6% 0050237 00502371 1/1   )-binding Rossmann-fold domains         
   3::233  2.4e-60 42.5% 0050955 00509551 1/1   )-binding Rossmann-fold domains         
   3::232  1.1e-59 41.9% 0038042 00380421 1/1   )-binding Rossmann-fold domains         
   2::238  1.7e-59 43.5% 0052529 00525291 1/1   )-binding Rossmann-fold domains         
   3::234  3.3e-59 41.7% 0039438 00394381 1/1   )-binding Rossmann-fold domains         
   2::236  3.9e-59 40.0% 0051440 00514401 1/1   )-binding Rossmann-fold domains         
   4::236  4.6e-59 43.8% 0046801 00468011 1/1   )-binding Rossmann-fold domains         
   4::235  5.5e-59 43.1% 0046483 00464831 1/1   )-binding Rossmann-fold domains         
   2::232  6.1e-59 42.6% 0043703 00437031 1/1   )-binding Rossmann-fold domains         
   1::236  7.3e-59 42.5% 0051006 00510061 1/1   )-binding Rossmann-fold domains         
   3::232  3.2e-58 41.7% 0035018 00350181 1/1   )-binding Rossmann-fold domains         
   1::236  6.3e-58 43.1% 0052085 00520851 1/1   )-binding Rossmann-fold domains         
   2::236  9.4e-58 41.2% 0053286 00532861 1/1   )-binding Rossmann-fold domains         
   4::232  9.5e-58 41.0% 0038068 00380681 1/1   )-binding Rossmann-fold domains         
   2::235  1.1e-57 41.0% 0051965 00519651 1/1   )-binding Rossmann-fold domains         
   3::232  1.1e-57 43.5% 0051542 00515421 1/1   )-binding Rossmann-fold domains         
   2::238  1.2e-57 42.1% 0052988 00529881 1/1   )-binding Rossmann-fold domains         
   1::232  1.3e-57 42.7% 0036806 00368061 1/1   )-binding Rossmann-fold domains         
   4::235  1.3e-57 42.8% 0036922 00369221 1/1   )-binding Rossmann-fold domains         
   2::236  1.4e-57 40.9% 0050383 00503831 1/1   )-binding Rossmann-fold domains         
   5::232  1.4e-57 41.7% 0042505 00425051 1/1   )-binding Rossmann-fold domains         
   4::232  2.4e-57 43.9% 0049845 00498451 1/1   )-binding Rossmann-fold domains         
   3::236  3.2e-57 43.4% 0051702 00517021 1/1   )-binding Rossmann-fold domains         
   3::232  4.3e-57 41.3% 0045153 00451531 1/1   )-binding Rossmann-fold domains         
   3::235  1.3e-56 41.7% 0050022 00500221 1/1   )-binding Rossmann-fold domains         
   5::232  1.9e-56 41.9% 0036194 00361941 1/1   )-binding Rossmann-fold domains         
   3::232    2e-56 42.8% 0040910 00409101 1/1   )-binding Rossmann-fold domains         
   3::235  2.6e-56 43.4% 0049942 00499421 1/1   )-binding Rossmann-fold domains         
   3::231  2.8e-56 41.6% 0041757 00417571 1/1   )-binding Rossmann-fold domains         
   3::238  2.8e-56 40.0% 0052368 00523681 1/1   )-binding Rossmann-fold domains         
   1::232  3.9e-56 40.9% 0035471 00354711 1/1   )-binding Rossmann-fold domains         
   1::235  4.7e-56 42.0% 0053266 00532661 1/1   )-binding Rossmann-fold domains         
   3::233  5.5e-56 42.9% 0038814 00388141 1/1   )-binding Rossmann-fold domains         
   3::232  8.7e-56 41.9% 0038770 00387701 1/1   )-binding Rossmann-fold domains         
   2::237  9.3e-56 41.2% 0049943 00499431 1/1   )-binding Rossmann-fold domains         
   4::239  9.6e-56 44.3% 0048243 00482431 1/1   )-binding Rossmann-fold domains         
   5::232    1e-55 41.4% 0042429 00424291 1/1   )-binding Rossmann-fold domains         
   1::232  1.5e-55 42.6% 0041610 00416101 1/1   )-binding Rossmann-fold domains         
   5::232  2.3e-55 45.8% 0051093 00510931 1/1   )-binding Rossmann-fold domains         
   3::232  5.8e-55 44.8% 0041366 00413661 1/1   )-binding Rossmann-fold domains         
   3::232  8.6e-55 42.3% 0038545 00385451 1/1   )-binding Rossmann-fold domains         
   2::232  9.3e-55 43.0% 0051279 00512791 1/1   )-binding Rossmann-fold domains         
   1::238  1.3e-54 42.9% 0041692 00416921 1/1   )-binding Rossmann-fold domains         
   3::237    2e-54 42.6% 0047470 00474701 1/1   )-binding Rossmann-fold domains         
   3::232  2.4e-54 40.0% 0039871 00398711 1/1   )-binding Rossmann-fold domains         
   2::240  1.1e-53 41.0% 0048949 00489491 1/1   )-binding Rossmann-fold domains         
   4::239  1.7e-53 42.3% 0051955 00519551 1/1   )-binding Rossmann-fold domains         
   3::232  3.9e-53 42.4% 0048614 00486141 1/1   )-binding Rossmann-fold domains         
   2::235  1.1e-52 42.1% 0051260 00512601 1/1   )-binding Rossmann-fold domains         
   2::238  1.4e-52 41.9% 0052873 00528731 1/1   )-binding Rossmann-fold domains         
   5::237  2.5e-52 44.3% 0050655 00506551 1/1   )-binding Rossmann-fold domains         
   3::229  3.7e-52 41.4% 0043678 00436781 1/1   )-binding Rossmann-fold domains         
   3::232  9.6e-52 42.7% 0035305 00353051 1/1   )-binding Rossmann-fold domains         
   1::236  1.8e-51 43.7% 0048286 00482861 1/1   )-binding Rossmann-fold domains         
   3::232  3.3e-51 40.6% 0038559 00385591 1/1   )-binding Rossmann-fold domains         
   3::236  4.7e-51 42.1% 0051355 00513551 1/1   )-binding Rossmann-fold domains         
   1::238  1.1e-48 38.9% 0052744 00527441 1/1   )-binding Rossmann-fold domains         
   3::232  1.8e-46 35.9% 0051203 00512031 1/1   )-binding Rossmann-fold domains         
   1::232  5.3e-46 42.6% 0051109 00511091 1/1   )-binding Rossmann-fold domains         
   5::235  1.1e-41 35.3% 0049026 00490261 1/1   )-binding Rossmann-fold domains         
   5::235  3.5e-41 36.1% 0046897 00468971 1/1   )-binding Rossmann-fold domains         
   4::235  9.3e-41 33.6% 0048293 00482931 1/1   )-binding Rossmann-fold domains         
   5::234  5.1e-40 35.0% 0050721 00507211 1/1   )-binding Rossmann-fold domains         
   5::232  1.2e-39 31.8% 0049864 00498641 1/1   )-binding Rossmann-fold domains         
   5::235  2.9e-39 34.3% 0046034 00460341 1/1   )-binding Rossmann-fold domains         
   4::235  1.1e-38 34.3% 0049519 00495191 1/1   )-binding Rossmann-fold domains         
   3::235    6e-38 33.5% 0049357 00493571 1/1   )-binding Rossmann-fold domains         
   5::232  4.3e-37 34.0% 0051183 00511831 1/1   )-binding Rossmann-fold domains         
   3::177  2.9e-36 38.9% 0049428 00494281 1/1   )-binding Rossmann-fold domains         
   5::235  1.5e-35 31.9% 0049117 00491171 1/1   )-binding Rossmann-fold domains         
   3::173  3.3e-33 38.2% 0048035 00480351 1/1   )-binding Rossmann-fold domains         
   5::232  1.1e-32 30.6% 0043337 00433371 1/1   )-binding Rossmann-fold domains         
   5::235  2.9e-32 31.2% 0053287 00532871 1/1   )-binding Rossmann-fold domains         
   5::176  3.5e-32 37.1% 0051491 00514911 1/1   )-binding Rossmann-fold domains         
   1::232  3.3e-31 32.9% 0046574 00465741 1/1   )-binding Rossmann-fold domains         
   1::233  7.4e-31 32.5% 0046472 00464721 1/1   )-binding Rossmann-fold domains         
   5::232  2.1e-29 28.8% 0046291 00462911 1/1   )-binding Rossmann-fold domains         
   1::232  3.1e-29 27.9% 0040043 00400431 1/1   )-binding Rossmann-fold domains         
   5::232  3.5e-29 31.0% 0041999 00419991 1/1   )-binding Rossmann-fold domains         
   6::232  2.6e-28 27.3% 0037128 00371281 1/1   )-binding Rossmann-fold domains         
   1::232  2.9e-26 28.6% 0043041 00430411 1/1   )-binding Rossmann-fold domains         
   5::232    1e-25 28.0% 0052722 00527221 1/1   )-binding Rossmann-fold domains         
   1::232  1.5e-25 30.4% 0051991 00519911 1/1   )-binding Rossmann-fold domains         
   1::232  2.3e-24 27.8% 0038324 00383241 1/1   )-binding Rossmann-fold domains         
   5::143    4e-24 36.7% 0046529 00465291 1/1   )-binding Rossmann-fold domains         
   3::184  5.9e-24 37.0% 0036785 00367851 1/1   )-binding Rossmann-fold domains         
   1::231  5.1e-23 27.3% 0043042 00430421 1/1   )-binding Rossmann-fold domains         
   5::167  1.8e-22 40.4% 0048516 00485161 1/1   )-binding Rossmann-fold domains         
   5::170  6.4e-22 34.1% 0048186 00481861 1/1   )-binding Rossmann-fold domains         
   4::175  1.6e-20 28.6% 0051925 00519251 1/1   )-binding Rossmann-fold domains         
   1::143  1.3e-18 33.1% 0047965 00479651 1/1   )-binding Rossmann-fold domains         
   1::235  1.5e-18 25.1% 0052116 00521161 1/1   )-binding Rossmann-fold domains         
   5::149  9.5e-17 33.3% 0038784 00387841 1/1   )-binding Rossmann-fold domains         
   3::158  6.9e-16 33.3% 0042180 00421801 1/1   )-binding Rossmann-fold domains         
   1::147  1.8e-15 31.3% 0035477 00354771 1/1   )-binding Rossmann-fold domains         
   1::135    7e-15 30.2% 0034872 00348721 1/1   )-binding Rossmann-fold domains         
   3::239  4.1e-14 23.0% 0051696 00516961 1/1   )-binding Rossmann-fold domains         
   5::102  1.1e-13 29.6% 0035290 00352901 1/1   )-binding Rossmann-fold domains         
   2::149  1.9e-13 31.9% 0049686 00496861 1/1   )-binding Rossmann-fold domains         
   5::233  1.2e-12 26.7% 0047178 00471781 1/1   )-binding Rossmann-fold domains         
   5::155  1.7e-10 30.9% 0051996 00519961 1/1   )-binding Rossmann-fold domains         
   3::133  1.6e-09 29.7% 0049198 00491981 1/1   )-binding Rossmann-fold domains         
   4::153  5.1e-09 24.1% 0050228 00502281 1/1   )-binding Rossmann-fold domains         
   3::126  9.5e-09 28.7% 0048455 00484551 1/1   )-binding Rossmann-fold domains         
   3::157  3.3e-08 31.9% 0048414 00484141 1/1   )-binding Rossmann-fold domains         
   1::142  4.5e-07 26.2% 0036007 00360071 1/1   )-binding Rossmann-fold domains         
   3::126    6e-07 23.6% 0042906 00429061 1/1   )-binding Rossmann-fold domains         
   5::123  6.6e-07 33.6% 0040551 00405511 1/1   )-binding Rossmann-fold domains         
   3::126  1.1e-06 27.4% 0053019 00530191 1/1   )-binding Rossmann-fold domains         
   1::111  3.8e-06 34.1% 0048270 00482701 1/1   )-binding Rossmann-fold domains         
   5::128  4.6e-05 34.4% 0042340 00423401 1/1   )-binding Rossmann-fold domains         
   5::128  5.5e-05 31.4% 0037437 00374371 1/1   )-binding Rossmann-fold domains         
   1::111    9e-05 21.0% 0045645 00456451 1/1   )-binding Rossmann-fold domains         
   1::238


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAERRTALVTGATKGIGLALSKHLQQLGWSVIGVARHAIEGFPGQLLTADLADIQQTDAVLAQVVAASRI
00515681   1/1  mdlkgkvalvTGassgiGlaiAralaaaGarVvltdrneekleelaaelealggrvlavalDvtdeesve
00499021   1/1  --kgkvalvtGasnesgIGraiAlalaeeGakVvltdrneealeelaaelealldeslllslelllelek
00476811   1/1  --kgkvalvTGassGiGlaiAralaaaGarlllVvltdrneekleelaaelrallpsggrvlavalDvtd
00450761   1/1  ----llvlllllllllslkgkvalvTGassgiGraiaralaaaGarVvlldrsseekleelaaelealgg
00421311   1/1  --kgkvalvTGassgiGraiAralaaeGarVvltdrnseekleelaaeleallggralavalDvtdeala
00503651   1/1  slkgkvalvtGassgiGlaiAralaeeGakVvltdrneekleelaaelealggkvlavalDvtdeesvea
00509671   1/1  --dlkgkvalvTGassgiGlaiAralaaeGarVvltdrneekleelaaelealglpsgrvlavalDvtde
00471241   1/1  --llmllslkgkvalvTGassGiGlaiAralaaaGarVvltdrseekleelaaeleallggrvlavalDv
00465921   1/1  ----mlldlkgkvalvtGaanssgiGraiAralaaeGarVvltdrneealeelaaeleaalpsslllele
00507761   1/1  mlkgkvalvTGassgiGlaiAralaaeGarVvltdlrneekleelaaellealggrvlavalDvtdeesv
00383421   1/1  --pslslkgkvalvTGasgGiGralaralaarGarVvlldrsglssllllsaekleelaaelggrvlava
00517631   1/1  mldlkgkvalvtGassgiGlaiaralaaaGarVvlldrneekleelaaegrvlavalDvtdeesvealve
00515111   1/1  -LkgkvalvTGAssGiGraiAralaalleegarVvlvarneekleelaaeleallpggrvlavalDvtde
00376621   1/1  --llllmllslkgkvalvTGassgiGraiAralaaaGarVvltdrneekleelaaelealggrvlavalD
00483611   1/1  ---GkvalvtGasnesgiGraiAlalaeeGakVvitdrneealeelaaeleallseellleleellelee
00502371   1/1  mdlkgkvalvtGassgiGlaiAralaaaGarVvltdrnaekleelaaellealggrvlavalDvtdeesv
00509551   1/1  --lllmlldlkgkvalvTGassgiGlaiAralaaaGarVvlldrneekleelaaeleallpggrvlaval
00380421   1/1  --mmlslkgkvalvTGassGiGlaiaralaaaGarVvlldrneekleelaaeleallggrvlavalDvtd
00525291   1/1  -gdlsgkvalvtGassgiGlaiAralaaeGarVvltdrn..eleelaaelealggrvlavalDvtdeesv
00394381   1/1  --mmslkgkvalvTGassgiGraiaralaaaGarVvltdrsgeekleelaaelealggrvlavalDvtde
00514401   1/1  -gsslldmldlkgkvalvTGasggiGraiAralaaaGarVvlldrneekleelaaeleaelplllggrvl
00468011   1/1  ---gkvalvTGassgiGraiaralaaaGarVvlldrneek......vqlDvtdeesvealveavleefgg
00464831   1/1  ---sgkvalvTGassGiGlaiAralaaeGakVvlltdrneekleelaeeleallggkvlavalDvtdlle
00437031   1/1  -mdlkgkvalvtGassGiGraiAralaaeGarVvltdrneekleelaaelrallplggrvlavalDvtde
00510061   1/1  mslkgkvalvTGassgiGlaiAralaaeGarVvltdrne.ekleelaaelealglpsgrvlavalDvtde
00350181   1/1  --mmdlkgkvalvTGassgiGlaiaralaaaGarVvlldrneekleelaaelralggrvlavalDvtdee
00520851   1/1  llsllsllkgkvalvtGassgiGlaiAralaaaGarVvltdrsaekleelaaelealggrvlavalDvtd
00532861   1/1  -sdmldlkgkvalvtGassgiGlaiAralaeeGakVvltdrneekleelaaelealggkvlavalDvtde
00380681   1/1  ---gkvalvTGasggiGlaiaralaaeGarVvlldrneekleelaaelealggrvlavalDvtdeesvaa
00519651   1/1  -smdlkgkvalvTGassgiGlaiAralaaaGarVvltdrneekleelaaeleaggrvlavqlDvtdeesv
00515421   1/1  --mmldlkgkvalvTGassGiGraiAralaarGarVvladrseelaeleagleklealaeelggrvlava
00529881   1/1  -llslkgkvalvtGasselgiGlaiAralaaeGarVvltdrneealeelaaeleggralavalDvtdees
00368061   1/1  dlkgkvalvTGassgiGlaiAralaaaGarVvlldrne.ekleelaaelggrvlavalDvtdeesvealv
00369221   1/1  ---gkvalvTGassgiGlaiAralaaaGarVvlldrsgaekleelaaelealggrvlavalDvtdeesve
00503831   1/1  -lllllllllllllldlllslldlkgkvalvTGasgGiGraiAralaaaGarVvlldrneekleelaael
00425051   1/1  ----kvalvTGassgiGraiAlalaaeGarVvltdrneealeelaggkalavalDvtdeesvealveaav
00498451   1/1  ---gkvalvTGassgiGralaralaarGarVvlldrsee.ggrvlavaaDvtdeesvealvaaalefgrl
00517021   1/1  --ldlkgkvalvtGassgiGlaiAralaaaGarVvlldrseekleelaaelggrvlavalDvtdeesvea
00451531   1/1  --psllslkgkvalvTGassgiGlaiAralaaaGarVvltdrneekleelaaelealggrvlavalDvtd
00500221   1/1  --lllslkgkvalvTGassgiGlaiAralaaeGarVvlldrseealervlavalDvtdeesvaalvaavl
00361941   1/1  ----mdlkgkvalvtGasggiGraiaralaaaGarVvlldrneekleelaaelg..rvlavvlDvtdees
00409101   1/1  --mmdlkgkvalvTGassgIGlaiaralaaeGarvvlldrneekleelaaelealpggrvlavalDvtde
00499421   1/1  --ldlkgkvalvtGassgiGlaiaralaaaGarVvlldrse.ekleelaaelrvlavalDvtdeesveal
00417571   1/1  --mmdlkgkvalvTGAssGiGraiAralaalleeGarvvltarneekleelaaeleallpggrvlavalD
00523681   1/1  --dllkgkvalvtGassgiGlaiaralaeeGakVvltdrneeleelaeelkvlavalDvtdeesvealve
00354711   1/1  MslkgkvvlvTGasggiGralaralaaaGarVvlldrseekleelaaelggrvlavalDvtdeesveaav
00532661   1/1  gslkgkvalvtGAaGssgiGlaiAralaeeGakVvltdrneekleelaellalgg.kvlavalDvtdees
00388141   1/1  --ldlkgkvalvTGassgiGraiaralaarGarVvlldrse.ekleelaaelggrvlavalDvtdeesva
00387701   1/1  --mmdlkgkvalvTGasggiGlaiaralaaeGarVvlldrneekleelaaelggrvlavalDvtdeesve
00499431   1/1  -lmlldlkgkvalvtGAagssgiGlaiAralaeeGakVvltdrneekleelaeeleelgkvlavalDvtd
00482431   1/1  ---lpvalvTGassGiGlaiAralaaaGarVvltdrlneekleelaaelralpggrvlavalDvtdeesv
00424291   1/1  ----mmlslkgkvvlvtGasggiGralaralaaaGarVvlldrseekleelaaelg..rvlavvlDvtde
00416101   1/1  mmslkgkvalvTGassgiGlaiAralaaeGarVvltdrneekleelaaeleaggrvlavalDvtdeesve
00510931   1/1  ----llllmlldlkgkvalvTGassGiGraiAralaaaGarVvltarneekleelaaelralggdrvlav
00413661   1/1  --mmdlkgkvalvtGassgiGlaiaralaaeGarVvlldrne.ekleelaaelggrvlavalDvtdeesv
00385451   1/1  --ldlkgkvalvTGasggiGlaiAralaaaGarVvlldrseekleelaaelggrvlavalDvtdeesvea
00512791   1/1  -lldlkgkvalvTGassgiGlaiAralaaaGarVvlldrneekleelaaelg.rvlavalDvtdeesvea
00416921   1/1  dlkgkvalvtGassgiGraiaralaaeGarVvltarneekleggralavvlDvtde..veaaleaf...g
00474701   1/1  --dlkgkvalvtGassgiGlaiAralaaeGarVvltdrneekleelaaelealggkarvlavalDvtdee
00398711   1/1  --mdlkgkvalvTGassgiGraiaralaaaGarVvlldrneekleelaaelggrvlavalDvtdeesvea
00489491   1/1  -gllkgkvalvtGAagssgiGlaiAralaeeGakVvltdrn..ekleelaeeleaaggkvlavalDvtde
00519551   1/1  ---kkvalvtGassgiGlaiAralaeeGarlllleeeVvltdrneekleelaaelealggkvlavalDvt
00486141   1/1  --kgkvvlvtGgsggiGsalaralaaeGakvvlvdrseealaegggalavaaDvtdeeavealveaavea
00512601   1/1  -sdmslkgkvalvTGasggiGlalAralaarGarVvlldrseekleelaaelealggrvlvvalDvtdee
00528731   1/1  -lkgkvalvTGassgiGlaiaralaaeGarVvlldrneekleelaaeleallpggrvlavalDvtdeesv
00506551   1/1  ----sGmkvalvTGassgiGlaiaralaealGakVvltdrneekleelaaelealggrvlfvalDvtdee
00436781   1/1  --mdlkgkvalvTGassgiGlaiAralaaaGarVvlldrse.ekleelaaelggrvlavalDvtdeesve
00353051   1/1  --mdlkgkvalvTGassGIGlaiAralaarGarvvlldrneekleelaaelralpggrvlavalDvtdel
00482861   1/1  mlkgkvvlvTGassGiGlalaralaarGasrVvlldrneekleelaaelealggrvlfvqlDvtdeesve
00385591   1/1  --egkvvLVtGgsggiGraiaralaaaGarVvvvdrseealgggvlavaaDvtdeeavaalvaaavelle
00513551   1/1  --lkgkvalvTGasggiGlaiaralaeeGdlakVvlldrneekleelaaelggrvlfvqlDvtdeesvea
00527441   1/1  amdlgllsgkvvlvTGasggiGralaralaarGarvVvlldrsglleekleelaaelealggrvlfvaaD
00512031   1/1  --dslsllslkgkvalvTGassGiGraiAralaeeGarVvltdrneekleelaaelealgggkvlavalD
00511091   1/1  sslsllldmlslkgkvalvTGasggiGralaralaarGarVvlldrseekleelaaelealgggrvlvva
00490261   1/1  ----ktvlvTGatGgiGsalaraLlarGaeVvaldrspeklealaaeleallpllllfellglldellgg
00468971   1/1  ----ktvlvTGatGgiGsalaraLlarpGaeVvaldrlsspeklealaallgalgvefvqgDltdpesla
00482931   1/1  ---nktvlvTGatGgiGsalaraLlarGaeVvlldrlssgaseekleelaaelraaggpgvefvqgDltd
00507211   1/1  ----ldmmslmgktvlvTGatGgiGsalaraLlarGaeVvlldrspekleelaaelealg.gvefvqgDl
00498641   1/1  ----krvLvTGgtGfiGsalaraLlerGaevvvldrseekleelleeleallggrvefvegDltdpeale
00460341   1/1  ----gktvlvTGatGgiGsalaraLlarpGaeVvaldrltsagspeklealaaelgvefvqgDltdpesl
00495191   1/1  ---rktvlvTGatGgiGsalaraLlarGaeVvlldrlssglspekleellaellealgggvefvqgDltd
00493571   1/1  --llsllsslldllslkgktvlvTGatGgiGsalaraLlarGaeVvlldrspekleelaaelealggsll
00511831   1/1  ----llllmmmslegktvLVTGAtGfiGsalvrrLlerGyeVvaldrspekleelaallealggdpgvel
00494281   1/1  --emktvlitGAnRGiGlelvkqllelakrgllviataRdpekaeeleelaaegsnlvilqldvtdeesi
00491171   1/1  ----ktvlvTGatGgiGsalaraLlallllslaGaevvaldrspseealealaellalggvefvqgDltd
00480351   1/1  --gllldtallvllllllllldlkgkvalVtGasggiGlaiAralaaaGarVvladrneeklealaaelg
00433371   1/1  ----ktvLVTGatGfiGsalaraLlerGyrVvaldrdpekleellaelealgggvefvegDltdpeslaa
00532871   1/1  ----lsgktvlVtGAtGgiGsalvrrLleagdvaevvalvrspekleelgg.gvevvvgDltdpdslaaa
00514911   1/1  ----SKtvlvTGatGgiGsalaraLlerGaeVvlldrspekleellaeleallgggvefvqgDltdpesl
00465741   1/1  M..gktvlvTGatGgiGsalaraLlarGaeVvlldrspsslllllekleelaaelealgggvefvqgDlt
00464721   1/1  M..gktvlvtGatGfiGsalaraLlarGaveVvaldrspe..........Dltdpeslaaalagv....r
00462911   1/1  ----skkvLvTGatGfiGsalvrrLlerGyeVialdrlssgsneekleellkelellgpgvefvkgDltd
00400431   1/1  M..gkkvLvTGgtGfiGsalvraLlerGaevvvldrdpegaaellallealggprvefvagDltdpeale
00419991   1/1  ----kkvLvTGgtGfiGshlaraLlerGaevvvldrls.egaeellaelealgprvefvkgDltdpeala
00371281   1/1  -----kvlVTGgaGfiGsalvraLlerGyeevvvldrlesgaklgpgvefvegDltdpesleaaleevek
00430411   1/1  M.sgkkvlvtGAtGfiGshlaraLleaGhevvalvRspekaalalalelleelaapgvevvegDltdpes
00527221   1/1  ----llllkillslkgkkvlvtGAtGgiGralvkellargavskvialvRrpekleelaaegvevvvgDl
00519911   1/1  lllllllimmmlkgkkvlvtGAtGgiGralvkeLlergavskVtalvRrpekleelaaegvevvvgDltd
00383241   1/1  M..gkrvLvTGgtGfiGshlvraLlerpGhevvvldrlpsgadallellalltlllslleklllllellg
00465291   1/1  ----PctplgvllllellgillllllmmlrlkgkvalVtGassgiGralAllLareGatVvvvdrneekl
00367851   1/1  --kgkkvlviGa.GgiGralaraLaeaGaevtvadrslekaealaaelggveavelDvtdeasldaal..
00430421   1/1  M.kgmkvlvtGgtGfiGshlvraLleaGhevvvlvRnpskgkaaklelleellglgvevvegDltdpesl
00485161   1/1  ----lsleeaAalplagltaylallllldlagllpgktvlvtGAaggiGsaaaqllaalGarViavdrse
00481861   1/1  ----kkvlvtGAsGgiGsalalllaargaevvlldrspeklegvaldlsdlgvevvvadltdpeslaeal
00519251   1/1  ---kkkilvtGatGfiGsalaraLlergyevialdrspekleellkllvefvkgDltdpesleealkg..
00479651   1/1  GkplvlggslgrseatgygvvysllaalkrllmglslegkvvlVtGaG.giGraiarrlaaeGakVvvtd
00521161   1/1  MslllllllllmlkgmkilVTGaaGfiGshlvrrLlerGyevvaldrspekleelldpgvefvegDltdp
00387841   1/1  ----kkvlvtGAsGgiGsalalllakegaevvlvdrdeekalealagelldlgggalvlvadvtdleave
00421801   1/1  --DgigavsllkrllvdlpgkkvlvlGaG.giGralalalaaagaevvvvnrtlekaeelaeelga...q
00354771   1/1  MlkgmkvlVtGAaGgiGsalalrlaarglagldllvevvlldrsealealegvaldlsdgalavlldltd
00348721   1/1  fhpinvgdlvtgllfdnllpctpsgvlellkatgidlaGkvavVtGasrgiGraiallLaaagatVtvcd
00516961   1/1  --kgkrvlvtGAtGfiGshlvrrLlaeghvsevvalvrrpsk..llpgvevvvgDltdp...laealag.
00352901   1/1  ----fgalnlgrlllgllglvpctplgilellerlgidlsgkvalVtGasggiGraiallLaraGatVtv
00496861   1/1  -AasilllgltsylallevlkikegkkVlvtGAtGgiGlavvrlllkrGykViaidrseekleklkelga
00471781   1/1  ----mmmmkvlvtGAtGfiGsalvrelleagheVtalvRdp.sklaallglgvevvvgDltdpaslaaal
00519961   1/1  ----MkvLvtGatGfiGshlvrrLlerghleVvgldrls.sgleellelpgvefvegDltdpealeeala
00491981   1/1  --lnpsemkgkrvlvtGgtGfiGsnlaelLlergyevvgldr.sepglnslldllllaeniafvkgDlsd
00502281   1/1  ---mmkvlitGAtGfiGselvrlLlehgdhevtaldrrtsagkllnepgvevvegdltdpddlekalk..
00484551   1/1  --DgiGfvellkrlgvdlkgktvlitGAG.gagraialalaklg.nvvianrtlekaealaeelgelgg.
00484141   1/1  --kgktvliiGa.GgvGlaiaqalaalGakkVvlvdrd....eekaqalveqlkelgskikvkavsldvg
00360071   1/1  lellllialenllllllllllellllsllkpmkVlVtGAaGfiGshlalrLlsgglagldqlvevvlldr
00429061   1/1  --aklkpgktvlvtGAaggvGlaaaqlakalGarViatarseeklellkelGadvvidykdedlvealke
00405511   1/1  ----ktvlvtGa.GgvGlaaaqlaaalGarViavdrseeklelarelgad..vvidvtdedlveavlelt
00530191   1/1  --kmmkvavtGAtGyiGralvrlLlerghpvvalvrlassasagkgvevvlgdltdldlla...aalagv
00482701   1/1  M....kilvtGanGqlGsalvrllaelgdvvvla........lgrdllllDltdpeavrellael....k
00423401   1/1  ----aGylavllaalllcrflgglgllltlagglagkkvlviGa.GgvGlaaarllaalGakVtvldrnp
00374371   1/1  ----agrlavleaalllervltglgalagllpgkrvlViGaG.giGleaAaalarlGakVtvvdrrpell
00456451   1/1  mienlllllelllelellkslkkpmkvlvtGAaGfiGshlallLasgglagldqvvelvlldiveslgkl


                         -         -         *         -         -         -         -:140
query           DAVINNAGIALPQKLESLDLPSLQTVFDLNVRAAVQVTQACLPSLKQSPAGRIVNVCSRAIHGARDRTSY
00515681   1/1  alveavleefgrldilvnnaGillplgplldlsledfervldvnllgtflltraalplmrkrgggrivni
00499021   1/1  llellaallelsdleggkalavaaDvtdeesvealvdaivekfgrldiLvnnagiagellgplldlsled
00476811   1/1  eesvealveav.efgrldiLvnnAGialpgpleelsledwervldvNllgtflltraalplmrkrgggri
00450761   1/1  rvlavalDvtdeesvealveavleefgrldilvnnAgillpgpleelsledfervldvnllgtflltraa
00421311   1/1  eeleelelllllllesvealveaalerfgrldilvnnAgialvgallglllllllllkplldlsledwdr
00503651   1/1  lveeileefgrldilvnnagillpgplldlsledwervldvnllgvflltkaalplllmrkrgggrivni
00509671   1/1  esvealveevleefgrldilvnnAgialpgpgllldlsledfervldvnllgtflltraalplmlkrg.g
00471241   1/1  tdeesvealveavleefgrldilvnnAgillpgplleltledfervldvnllgvflltraalplmrkrgl
00465921   1/1  elleleelleleaaleeleeleggralavaaDvtdeesvealvaaaveefgrldiLvnnagiallllgpl
00507761   1/1  ealveevleefgrldilvnnagialpgplldlsledfervldvnllgtflltraalplmrkrgggrivni
00383421   1/1  lDvtdeesvealveaaleefgrldilvnnAgilldgplleltledwervldvnllgtflltraalplmrk
00517631   1/1  e...fgrldilvnnagillvgplldlsledfervldvnllgtflltraalpllrkrgggrivnisSvagl
00515111   1/1  esvealveavlellleefgrldilvnnAGillplllgplleltledwdrvldvnllgvflltraalplmr
00376621   1/1  vtdeesvealveaileefgrldilvnnagillp.pllelsledfervldvnllgvflltraalplmrkrg
00483611   1/1  lleleaaleeledleggkalavaaDvtdeesvealvdaaverfgrldiLvnnagialllggplldlsled
00502371   1/1  ealveavleefgrldilvnnagillpgplldlsledfervldvnllgvflltraalpllrkrgggrivni
00509551   1/1  DvtdeesvaalvaavleefgrldilvnnAgillpgpllelsledwervldvnllgtflltraalplmrkr
00380421   1/1  eesvealveaaleefgrldilvnnagillpgplldlsledfervldvnllgtflltraalplmrkrglgg
00525291   1/1  ealveavleefgrldilvnnagillpgplldlsledfervldvnllgvflltraalpllrkrgggrivni
00394381   1/1  esvealveavleefgrldilvnnagillpgplldlsledfervldvnllgtflltraalplmlkr..gri
00514401   1/1  avalDvtdeesvealveeileefgrldilvnnAgilavgpledlsledfervldvNvlgtflltraalpl
00468011   1/1  rldilvnnAGialpgpll.......ervldvNllgtflltraalpllrkrgggrivnisSlavygalldl
00464831   1/1  lleleleelleleleesvealveeileefgrldilvnnAGialpgpllllkslllsellgslldlsledw
00437031   1/1  esvealveavleefgrldilvnnagillpllllgplldlsledfervldvnllgvflltraalpllrkrg
00510061   1/1  esvealveavleefgrldilvnnaGialpgplegslldlsledfervldvnllgtflltraalplmlkrg
00350181   1/1  svealveavleefggrldilvnnagillpgplldltledfervldvnllgtflltraalpllrkrgggri
00520851   1/1  eesvealveavleefgrldilvnnagillpgplldlsledfervldvnllgtflltraalpllrkrgggr
00532861   1/1  esvealveeileefggrldilvnnagilllgplldlsledwervldvnllgvflltkaalplmrkrgggr
00380681   1/1  lveavleefgrldilvnnagillvgplldlsledfervldvnllgtflltraalplmrkrglggrivnis
00519651   1/1  ealveevleefgrldilvnnAgilgpllgplldlsledfervldvnllgtflltraalplmrkrgggriv
00515421   1/1  lDvtdeesvaalvaavleefgrldilvnnAGilldgpleeltledwervldvnllgaflltraalplmrk
00529881   1/1  vealvaaavellgefgrldilvnnagialllllllgplldlsledwdrvldvnllgvflltraalplmre
00368061   1/1  eaaleefgrldilvnnAgillpllllllgplldlsledfervldvnllgtflltraalplmrkrgaesgg
00369221   1/1  alvaavleefgrldilvnnagilldgplldltledfervldvnllgtflltraalplmrkrgggrivnis
00503831   1/1  eallggrvlavalDvtdeesvealveeileefgrldilvnnAgilavgpledlsledfervldvNllgtf
00425051   1/1  eefgrldiLvnnagialllgplldlsledwdrvldvnllgvflltraalplmlkrgggrivnisSvaglv
00498451   1/1  dilvnnAgillpllllgplldlsledwdrvldvnllgtflltraalplmrkrgaasgggggrivnisSva
00517021   1/1  lvaavleefgrldilvnnagilllgplldlsledwdrvldvnllgtflltraalplmlkr..grivnisS
00451531   1/1  eesvealveaileefggrldilvnnagillpgplldltledfervldvnllgvflltraalplmrkrggg
00500221   1/1  eefgrldilvnnagilllgplldltledfdrvldvnllgvflltraalplmrkrgggrivnisSvagllg
00361941   1/1  veaaveel...ggldvlvnnagialpgplldlsledfervldvnllgtflltraalplmrkrglggrivn
00409101   1/1  lesvealveealeefgridilvnnAGi........lsledwervldvNllgtflltraalplmrkrglgl
00499421   1/1  vaavleefgrldilvnnagilldgplldltledfdrvldvnllgtflltraalplmrkrgggrivnisSv
00417571   1/1  vtdeesvealveavlellleefgrldilvnnAGillplllgpllelsledwdrvldvnllgvflltraal
00523681   1/1  eileefgrldilvnnagilllgplldlsledwervldvnllgvflltkaalplmrkrgggrivnisSvag
00354711   1/1  eavleefggldvlvnnAgillvlllllgpledlsledwervldvNvlgtflltraalplmrkag.grivn
00532661   1/1  vealveeileefgrldilvnnaGiagklellgplldlsledwervldvnllgtflltkaalplm..rggg
00388141   1/1  alvaavleefgrldilvnnagvlldgplldltledfervldvnllgtflltraalpllrkrgggrivnis
00387701   1/1  alveavleefgrldilvnnAgialpgplldlsledfervldvnllgtflltraalplmrkrg.grivnis
00499431   1/1  eesvealveeileefgrldilvnnaGiaglslllgplldlsledwervldvnllgvflltkaalplm..r
00482431   1/1  lellealveavleefgrldilvnnaGialpgpllgllllllllldlsleadwervldvnllgvflltraa
00424291   1/1  esveaaveel...ggldvlvnnagiallgplldlsledfervldvnllgtflltraalplmrkaglggri
00416101   1/1  alveavleefgrldilvnnagillpgplldltledfervldvnllgtflltraalplmrkrglggrivni
00510931   1/1  alDvtdeesvealveavleefgrldilvnnAgillpgpledltledwervldvNllgvflltraalp.ml
00413661   1/1  ealveavleefgrldilvnnagillpgplldlsledfervldvnllgtflltraalpllrkrgggrivni
00385451   1/1  lvaealeefgrldilvnnAgillvgplldlsledfervldvnllgtflltraalpllrkrgggrivnisS
00512791   1/1  lveavleefgrldilvnnagillvlgplldlsledwervldvnllgtflltraalplmrkrg.grivnis
00416921   1/1  rldilvnnagiallgplldlsledwdrvldvnllgvflltraalplmlkrgggrivnissvagllglpgl
00474701   1/1  svealveavleefgrldilvnnagillplgplldlsledfervldvnllgvflltraalpllrkrgggri
00398711   1/1  lvaavleefgrldilvnnAgillvgplldlsledfervldvnllgtflltraalplmrkrglggrivnis
00489491   1/1  esvealveeileefgrldilvnnaGildldllllgplldlsledwervldvnllgvflltkaalplm..r
00519551   1/1  deesvealveeileefgrldilvnnagillpgplldlsledwervldvnllgvflltkaalplmkkrggg
00486141   1/1  fggldvlvnnagillplgplldlsledwdrvldvnllgtflllraalpllvk.g.grivnisSvagygpl
00512601   1/1  svealveevleefgrldilvnnAgillvgplldlsledfervldvnllgtflltraalplmrkrgggriv
00528731   1/1  ealveevleefgrldilvnnaGil........sledfervldvnllgtflltraalpllrkrglggggri
00506551   1/1  svealveeileefgrldilvnnAGil.vgpledlsleldfervldvNllgtflltkallplmkks..gri
00436781   1/1  alvaaaleefgrldilvnnAgillpllllllgplldlsledfervldvnllgtflltraalplmrkrgae
00353051   1/1  esvealveevleefgrldilvnnAGi........lsledwervldvNllgvflltraalplmrkrglglg
00482861   1/1  alveevleefgrldilvnnAGil..gpledlsledfllervldvNvlgtflltraalplllk..ggrivn
00385591   1/1  fggldvlvnnagilavgeplldlsledwdrvldvnllgtflllraalplmvk.g.grivnissvaglggl
00513551   1/1  lveeileefgrlgldilvnnAgillplgplldlsledfervldvNllgtflltkaalplmkkrgalssge
00527441   1/1  vtdpesvealvaeileefgldvlvnnAgillvgpledlsledfervldvnvlgtfnllraalpl....gv
00512031   1/1  vtdeesvealveeileefgrldilvlnnAGillpgpled.sledwervldvNllgtflltkaalplm.kr
00511091   1/1  aDvtdeesvealveeileefgrldilvnnAgillpdgpled.sledfervldvNvlgtflltraalp.lr
00490261   1/1  rvefvegDltdpesleaaleev....gvDvvvhnAgissvgpse.ltledpeevldvNvlgtlnlleaal
00468971   1/1  aalagv....ridvvihnAgiv....lvdlseedpeevldvNvlgtlnlleaalpagvkrggggglslri
00482931   1/1  peslaaalagv....rldvvvhnAgissv....dlseedpeevldvNvlgtlnlleaalpagvkrggggr
00507211   1/1  tdpeslaaalagv....riDvvvhnAgi....plvdlseedpeevldvNvlgtlnlleaa....rkagtv
00498641   1/1  aaleev....gvdvvihlAgissv....dlseedpeevldvNvlgtlnlleaarka....gvgrivfiSS
00460341   1/1  aaalagv....riDvvihnAgivsv....dlseedpeevldvNvlgtlnlleaalpagvkrggggglslr
00495191   1/1  peslaaalagv....rldvvvhnAgivgv....dlseedpeevldvNvlgtlnlleaalpagvksg.gri
00493571   1/1  lggvefvqgDltdpesleaala......gvdvvvhnAgivgv....dlseedpeevldvNvlgtlnllea
00511831   1/1  vvgDltdpesleaale......gvdvvihlAgiasvg.......edpeelidvNvlgtlnlleaarka..
00494281   1/1  eelaaeveellgdggldvlinnAGillpsgslgeldleellevfevnvlgpllltqallpllkkgaakks
00491171   1/1  peslaaala......gvdvvvhnAgivsv....dlseedpeevldvNvlgtlnlleaarka....gvgri
00480351   1/1  algralavaadvtdpesvealv......ggldilvnnagilgallgplldltledwervldvnllgtfll
00433371   1/1  alagv....rpdvvvhlAalssv....dlseedpeevldvNvlgtlnlleaarea....gvvgrivfvSS
00532871   1/1  la......gvdavvhlagivgvgalllllllksllelseedpeevldvnvlg....tlnlleaakaagvk
00514911   1/1  aaaleev....gvdvvvhnAgivgv....dlseedpeevldvNvlgtlnlleaalpa....gvgrivfvS
00465741   1/1  dpeslaaaleev....gvdvvihnAgi....plvdlseedpeevldvNvlgtlnlleaalpa....gvgr
00464721   1/1  vdvvihlAgivsav....dlseedpeevldvNvlgtlnlleaarka....gvkrivfvSSiavyggpggl
00462911   1/1  pesleealkgv....kpdvvihlAaivhv....dlseedpeetidvNvlgtlnlleaarkagvksg.grf
00400431   1/1  aala......gvdaVvhlAalshv....dlseedpeevlevNvlgtlnlleaarka....gv.rfvfiSS
00419991   1/1  alleei....gvdaVihlAaissv....dlseedpeevldvNvlgtlnlleaarka....gvkprfvfiS
00371281   1/1  fggvdvvihlAaissvd..es....dpeelldvNvlgtlnlleaarka....gv.rfvytSSaavyggpp
00430411   1/1  laealk......gvdvVihlag.......................dvnvlgtlnlleaakkagvkrfvfv
00527221   1/1  tdpeslaealk......gvdvvinaagttrfg.......edleeflavnvdgtlnlaeaakka....gvk
00519911   1/1  peslaaalk......gvdvvinaagitrvg.......edleefldvnvdg....tlnlldaakkagvkrf
00383241   1/1  prvefvegDltdpealaaala...efggvdvVihlAalvhv....dlseedpeevldvNvlgtlnlleaa
00465291   1/1  eelaeeieaaggkavvldvsdeedlkelv......grlDilvnnagipllkplldltkegwdvidvgvld
00367851   1/1  ....gdaDvvinaapvglhaeiveaaleagkhvvdenpla..aetralleaakeagvgrivnvssaagya
00430421   1/1  aealk......gvDvVihlagl...............evidvnvlgtlnlleaakea...gnvkrfvfvS
00485161   1/1  eklellkelgadvvidvtdedaveal..agggvdvvvnnaggatlgallel.lapggrvvlvnllgglll
00481861   1/1  kg......advvviaagip......rkpgedrldlldvnvlgvknlleaaaka....gvgrivlvssnpv
00519251   1/1  ....vdvvihlAaivgv....dlseedpeetidvNvlgtlnlleaar....kagv.rfvfiSSsavygdp
00479651   1/1  inpealeaaaaelgaevvsggealavacdvtdpaavealidaavaafgkldilvnnAgiplvdpeallil
00521161   1/1  ealeeale......gvdaVihlAalssvg.......eseedppleflevNvlgtlnlleaarkagvkrfv
00387841   1/1  dlvealggadvvvnnagvp......rkpgeerldllevnvlgtknlaealkka....gpgrivvvsspag
00421801   1/1  gdvsdleeleeal......ggaDivvnatgaglpglllelllellkpggvvvdvaypp..llttallpla
00354771   1/1  tddlaealk......gadvvvhlagv......prkpgedrddllavnvlg....tralleaarkagvgri
00348721   1/1  rdted...leelvke.adivvtavgvpdlvkaelgkpgalVnnaGinrl..fdeetledwllvgd-----
00516961   1/1  .vdvvihlagvvrf......sagdpeaflavnvdgtlnlleaa....raagvkrfvlvSslgaygd.pls
00352901   1/1  tdrntenleeavkeaDivivavgvpglvkael--------------------------------------
00496861   1/1  d......vvldvtdveellkallklggvdvvihtag....apvtelslsllkqllrvnvlgtlnllrall
00471781   1/1  a......gvdaVihlag...........padpldllevnvdgtrnllea....akaagvkrlvlvssaga
00519961   1/1  k.....gvdaVihlAalvsv..deseedpl..efievnvlgtlnlleaarka....g.krfvfaSsaavy
00491981   1/1  kealkraladv....kpdvVihlAavsgp....rvsaadpeavydtnvlgtlnllea....ak-------
00502281   1/1  ....gvDvvihaagtsrvdeslkdal.......gtnvigtssalrllnlleaakeagvkrfvhvstagvy
00484551   1/1  avkvdvldlddlaealg......gadilinatgagmpplledllpldlalllkvnv--------------
00484141   1/1  dveeleell......gkvDivinaaglgepaklldllvellervksgnvlgdlllapevlplleeasekg
00360071   1/1  leslekleglaldlsdaatfllgdvsdtadleealk......gadvvvhlAgvprkpgmdrldllk....
00429061   1/1  ltggrgvdvvlnnvggetldaaldllapg.grvvlvglisgynlpllllllllkgl--------------
00405511   1/1  ...ggvDvvvdaagvpatleealrllkpggrlvlvgvaggllpldlarlllkg-----------------
00530191   1/1  dvvflaaga..........................gatlalaeaaaaagvkvidls--------------
00482701   1/1  pdvvinaaAytavdkaes....dpelayavNvlgplnLaea-----------------------------
00423401   1/1  ekleqleelgadavevdvsdtadleelvaea......Dvvinaagipgat........------------
00374371   1/1  erleelgakfvlltldeelvevvlaltvdvsdeegrlkavetleellgeaDvvivaag------------
00456451   1/1  egvaldlsdaafpllgdvtvgtdlyeafkgadvvvhlAgvp-----------------------------


                         +         -         -         -         -         *         -:210
query           AAAKSALIGVTRTWALELAPLGITANAVAPGPVETELFRLTHPVGSDEEKRILATIPMQRLGKPEEVASL
00515681   1/1  sSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrgllallllllllllll
00499021   1/1  wdrvldvnllgvflltkaalplmkk.g.gsIvnissiaglrglpglalayaasKaAlegltrslalelap
00476811   1/1  vnisSvagllglpglaaYaasKaalegltrslalelaptgirvnavaPGlvdTpllrallaalallllll
00450761   1/1  lplmlkr..grivnisSvaglllglpglaaYaasKaalealtrslalelaprgirvnavapglvdTpmla
00421311   1/1  vldvnllgtflltraalplmrkrsaessggggrivnisSvagllglpglaaYaasKaalegltrslalel
00503651   1/1  sSvagllglpglaaYaasKaalegltrslalelapkgirvnavapglvdTpllrgllgllallllllpee
00509671   1/1  rivnisSlvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrgllallllll
00471241   1/1  ggrivnisSvagllallllllglpglaaYaasKaallgltrslalelaprgirvnavaPglvdTpllagl
00465921   1/1  ldlsledwdrvldvnllgvflltraalplm..rgggsivnissvaglvglpglalayaasKaAlegltrs
00507761   1/1  sSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrgllallllllllllpe
00383421   1/1  rglgrivnisSvagllglpgqaaYaasKaalegltrslalelaprgirvnavapglvatplterllrlgl
00517631   1/1  llglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllrgllpllllpeelleallalip
00515111   1/1  krgllggrivnisSvagllglpglaaYaasKaallgltrslalel..tgirvnavaPglvdTdllaalll
00376621   1/1  ggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllagll..peel
00483611   1/1  wdrvldvnllgvflltqaalplmkk.g.gsIvnissiaglvglpglalayaasKaAlegltrslalelap
00502371   1/1  sSvagllgglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllagllld.eellealla
00509551   1/1  gldggrivnisSvagllglpllglaaYaasKaalegltrslalelllaprgirvnavapglvdtpllral
00380421   1/1  rivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrglll.deelle
00525291   1/1  sSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllallgllgpeellellla
00394381   1/1  vnisSvaglllglpglaaYaasKaalealtrslalelaprgirvnavapglvdTpllagllallllllll
00514401   1/1  lrkrgggrivniSvagllglpgqaaYaasKaalegltrslalelaprgirvnavaPglvdTpllaallll
00468011   1/1  pllelllllllldlledvaglrglplglaaYaasKaalegltrslalelaprgirvnavaPglvdTpllr
00464831   1/1  er.ldvNllgvflltkaalplmkkaaklskrgggrivnisSvaglrglpglaaYsasKaalegltrslal
00437031   1/1  .grivnisSvagllvglpglaaYaasKaalegltrslalelaptgirvnavaPglvdTpllrglllllll
00510061   1/1  .grivnisSlvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrglla.pee
00350181   1/1  vnisSvagllglpglaaYaasKaalealtrslalelaprgirvnavapglvdTpllaalllllllleell
00520851   1/1  ivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllaal...leellea
00532861   1/1  ivnisSvagllglpglaaYaasKaalegltrslalelapkgirvnavapglvdTpllrglld..eellea
00380681   1/1  SvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrallalllllllllleev
00519651   1/1  nisSvagllglpgllaaYaasKaalegltrslalelaprgirvnavaPglvdtpllaallldleelleal
00515421   1/1  rgggrivnisSvagllglpgqaaYaasKaallgltrslalelaprgirvnavaPGlvdTpmtaalle...
00529881   1/1  .g.gsivnissvgllglpglaayaasKaalegltrslalelaprgirVnavaPgpirTpllaallaalaa
00368061   1/1  gggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllagllg..ee
00369221   1/1  SvagllglpgqaaYaasKaalealtrslalelaprgirvnavapglvdtpllaal...leelleallali
00503831   1/1  lltraalplllkrglggrivnisSvagllglpgqaaYaasKaalegltrslalelaprgirvnavapglv
00425051   1/1  glpglaaYaasKaallgltrslalelaprgirvnavaPglvdTpmlaalllglllllleelleallalip
00498451   1/1  gllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllagllp..eellallldgiplg
00517021   1/1  vaglglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllaal...leelleallalipl
00451531   1/1  rivnisSvagllglpglaaYaasKaalealtrslalelaprgirvnavapglvdTpllaallllllleel
00500221   1/1  lpgqaaYaasKaalealtrslalelaprgirvnavapglvdtpllaal...leelleallaliplgrlgt
00361941   1/1  issvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvatpllralll.leellealla
00409101   1/1  ggrivnisSvagllglpglaaYaasKaalegltrslalelaptgirvnavapglvdTellralllllall
00499421   1/1  aglglpgqaaYaasKaalegltrslalelaprgirvnavapglvdtpllaal...leelleallaliplg
00417571   1/1  plmrkrgllggrivnisSvagllglpglaaYaasKaallgltrslalel..tgirvnavaPglvdTdlla
00523681   1/1  llglpglaaYaasKaalegltrslalelapkgirvnavaPglvdtpllrglllllllpeelleallklip
00354711   1/1  isSvaglgglpglaaYaasKaalegltrslarelap.girvnavapglvdtpllrglllpllllalllge
00532661   1/1  rivnisSiagllglpglaaYaasKaalegltrslalelapkgirvnavapglvdTpllrgl.llpeelle
00388141   1/1  SvagllglpgqaaYaasKaalealtrslalelaprgirvnavapglvatpllaal...leellelllali
00387701   1/1  SvagllglpglaaYaasKaalegltralalelaprglgirvnavapglvatpllrgllllalleellall
00499431   1/1  gggrivnisSvagllglpglaaYaasKaalegltrslalelapkgirvnavaPglvdTpllrglll.lee
00482431   1/1  lp..llrggglssglggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavaPglv
00424291   1/1  vnissvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvltpllralll.leellaal
00416101   1/1  sSvagllglpglaaYaasKaalegltrslalelllaprgirvnavapglvdtpllagllp..eellelll
00510931   1/1  krgggrivnisSvagllglpglaaYaasKaalegltrslalelaprglgirvnavaPGlvdTpllrglla
00413661   1/1  sSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpll........eallellal
00385451   1/1  vagllglpglaaYaasKaalealtrslalelaprgirvnavapglvatpllagl...lpellelllalip
00512791   1/1  SvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrglllllllleelleall
00416921   1/1  aaYaasKaalegltrslalelaprgirvnavaPglvdTpllaglld..eellelllaliplgrlgtpeev
00474701   1/1  vnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrgllpllllllpee
00398711   1/1  SvagllglpglaaYaasKaalealtrslalelaprgirvnavapglvatpllagllllllllllllleel
00489491   1/1  gggrivnissvagllglpglaaYaasKaalegltrslalelapkgirvnavaPglvdTpllrglll.lee
00519551   1/1  rivnisSvagllglpglaaYaasKaalegltrslalelapkgirvnavapglvdtpmlaallle......
00486141   1/1  pglaaYaasKaavegltrslalelapllkgirvnavapglvdtpllra...........lgdgtplgrlg
00512601   1/1  nisSvagllglpglaaYaasKaalegltrslalelaplgltgirvnavapglvdtpllaallaa......
00528731   1/1  vnisSvagllglpglaaYaasKaalegltrslalllelaptgirvnavapglvrtpllagllplllllll
00506551   1/1  vnisSiagllglpdlglllleelllddlllldllellslllelllealleelllglaaYaasKaaleglt
00436781   1/1  sglgggrivnisSvagllglpglaaYaasKaalegltrslarelaprgirvnavapglvatpllagllg.
00353051   1/1  grivnisSvagllglpglaaYaasKaalegltrslalelaptgirvnavaPglvdTpllaglll.dpell
00482861   1/1  vsSvagllglpglddllleelllsdllllllldlllelldlllplledtplgplaaYaasKaalegltrs
00385591   1/1  pglaaYgasKaavegltrslalelapllkgirvnavapgnvdtpmlrg...........lldgtplrrlg
00513551   1/1  llslgggrivnisSiagllglpglgllelplaaYaasKaalegltrslalelapkgirvnavapglvdTp
00527441   1/1  grivniSSiagvlgspgqsaYaasKaalealtrslaae....girvnavrpglvatp......glveell
00512031   1/1  gggrivnisSiagllglpgqaaYaasKaalegltrslalelllapkgirvnavaPGlvdtpllaalllal
00511091   1/1  krglgrivnisSiagllglpgqaaYaasKaalealtrslalelallprgirvnavaPGlvdtp.......
00490261   1/1  pa....gvggrivfvSSiavygdpdgpidEddlllvllllllllltplpplsaYgasKaaaelllralar
00468971   1/1  vfvSSiavyggpggllevllesllgpldeddplnplspYgasKaaaeallralarel...girvtilrpg
00482931   1/1  ivniSSigvygdpggpidEddplnplsaYgasKaaaeallralarel...girvtilrpgnvygpggrpg
00507211   1/1  grivnvSSagvygdpglggpidEddpldplspYgasKaaaeallralarelaptglllelgirvtivrpg
00498641   1/1  aavyggseegpidEddpldpplspYgasKaaaellaralarel..ygirvvilrpgnvygpglrpllged
00460341   1/1  ivfiSsiavygglpgqsgpitEddpldplspYgasKaaaeallralarel...girvtilrpgnvygpg.
00495191   1/1  vniSSiavygdpeglpidEdtplpplspYgasKaaaeallralarel...girvtilrpgnvygpggrpl
00493571   1/1  alpa....gvgrivniSSigvyggpggapidEddplnplspYgasKaaaeallralarel...girvtiv
00511831   1/1  ..gsvkrivfvSSiaavygdplllpglpidEdtwldvdllaalllllelplpplspYgasKaaaealara
00494281   1/1  geglslsralivnissllGsigdntsgglyaYrasKa---------------------------------
00491171   1/1  vfvSSigvyggpgglpidEdtplpplspYgasKaaaeallralarel...glrvtilrpgnvygpgggp.
00480351   1/1  traalplmlarg.grivnissiagllglpglaa-------------------------------------
00433371   1/1  aavyggppglpidEdtplnplspYgasKaaaellaralare...yglrvvilrpgnvygpggrpdgvtsn
00532871   1/1  rivlvSslgayggdedtplpplspygasKaaaeallra.......sglrvtilrpglvlgpllsg...lr
00514911   1/1  SiavyggllllppglpidEddplnplspYgasKaaa----------------------------------
00465741   1/1  ivfvSSiavygdpdglpidEgdpglpplspYgasKaaaelllralare..gsgirvtilrpgnvygpgls
00464721   1/1  pidEddllllplnplsapYgasKaaaelllralarel...glrvtilrpgnvygpggrpllglsgvlprl
00462911   1/1  vfiSSsavyggppglpidEddplnplspYgasKaaaelllrayakey...glrvvilrpgnvyGpgggpd
00400431   1/1  aavyggspllllllglllldglpidEdtpldplspYgasKaaaellvrayare...yglrvvilrpgnvy
00419991   1/1  SaavyggspgqpldesllldvdllpllaitEdtplnplspYaasKaaaealarayare...yglrvvilr
00371281   1/1  glpidEdtplnplspYgasKaaaellvralare...yglrvvilrpgnvygpggrpdgltssviplllrl
00430411   1/1  SsagvygdedtplpplspygasKaaaeallral.......glpvtivrpgnvygpglsg....iplllrl
00527221   1/1  rfvlvSslgalgpspsp.yaasKaaaeallral.......glprvtivrpglvlgplgeplpgelllagg
00519911   1/1  vlvSslgalgpspsp.yaasKaaaeallral.......gldlvtivrpglvlgpllspllgealllpgll
00383241   1/1  rka....gvkrfvfaSSaavyggnplllllddelpidEddplnplspYgasKaaaeklvrayare...yg
00465291   1/1  vnl-------------------------------------------------------------------
00367851   1/1  dgrglpayqaakaalealllglalelgiagirvnailpgfvetp--------------------------
00430421   1/1  sagvygdedtplnplspygasKaaaekllra.......sglpvtilrpgnvygpgl...sgliplllkla
00485161   1/1  trallplllkrgkgrivns........-------------------------------------------
00481861   1/1  dgl....ayaaskaaleg...........s----------------------------------------
00519251   1/1  kkgpidEddllllnplnplspYgasKlaaekllra-----------------------------------
00479651   1/1  ler-------------------------------------------------------------------
00521161   1/1  faSSsavygdpeglpidEdtlldvdleplnplspYgasKlaaellarayare...ygldvvilrpfnvyG
00387841   1/1  llglpalkv-------------------------------------------------------------
00421801   1/1  rarglgrivdglsmlvlq----------------------------------------------------
00354771   1/1  vvvssgn---------------------------------------------------------------
00348721   1/1  ----------------------------------------------------------------------
00516961   1/1  pyarsKaaaeallral.......glprvtilrpglvygprdgfllallll.llllgdgdqrrspihvddv
00352901   1/1  ----------------------------------------------------------------------
00496861   1/1  pllvklgvk-------------------------------------------------------------
00471781   1/1  ygdepgpplplspyaaskaaaeellra.......sgldytilrpgalfgpg.......rtgvllllgdgd
00519961   1/1  gdpeglpidEddwld-------------------------------------------------------
00491981   1/1  ----------------------------------------------------------------------
00502281   1/1  gllegvpelleda---------------------------------------------------------
00484551   1/1  ----------------------------------------------------------------------
00484141   1/1  irvvtglsilgeqgpaq-----------------------------------------------------
00360071   1/1  ..--------------------------------------------------------------------
00429061   1/1  ----------------------------------------------------------------------
00405511   1/1  ----------------------------------------------------------------------
00530191   1/1  ----------------------------------------------------------------------
00482701   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00456451   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ISYLISDGASFVTGQVIGIDGGGSLGGR------------------------------------------
00515681   1/1  llpeevaeallaliplgrlgtp------------------------------------------------
00499021   1/1  rlgIrVnavaPGpikTpmlaallgllaell----------------------------------------
00476811   1/1  llllldllelleallaliplgrlgt---------------------------------------------
00450761   1/1  alllllllllllilvleellealla---------------------------------------------
00421311   1/1  aprgirvnavaPglvdTpmlral..---------------------------------------------
00503651   1/1  vaeallkliplgrlgtpedvagavlf--------------------------------------------
00509671   1/1  lllelleallaliplgrlgtpedvad--------------------------------------------
00471241   1/1  ...peelleallaliplgrlgtpee---------------------------------------------
00465921   1/1  lalelaprlgirVnavaPgpidTpl---------------------------------------------
00507761   1/1  evaealldliplgrlgtpedvadavl--------------------------------------------
00383421   1/1  lllspeevaeallaallsgepvvvv---------------------------------------------
00517631   1/1  lgrlgtpedvadavlflasdaasyi---------------------------------------------
00515111   1/1  dllleelleallaliplgrlgt------------------------------------------------
00376621   1/1  leallaliplgrlgtpeevaea------------------------------------------------
00483611   1/1  rlgIrVnavaPgpiltpmlaallga---------------------------------------------
00502371   1/1  liplgrlgtpeevadavlflasdaas--------------------------------------------
00509551   1/1  le...elleallaliplgrlgtp-----------------------------------------------
00380421   1/1  allaliplgrlgtpeevaeavl------------------------------------------------
00525291   1/1  lip.rlgtpeevadavlflasdaasyvt------------------------------------------
00394381   1/1  lllpeelleallaliplgrlgtpe----------------------------------------------
00514401   1/1  lpeellealldliplgrlgtpedvad--------------------------------------------
00468011   1/1  gllal.eelleallalilplgrlgtp--------------------------------------------
00464831   1/1  elapkgirvnavaPGllvdTpllr.---------------------------------------------
00437031   1/1  lllleelleallaliplgrlgt------------------------------------------------
00510061   1/1  lleallellellldliplgrlgtped--------------------------------------------
00350181   1/1  eallaliplgrlgtpeevaeav------------------------------------------------
00520851   1/1  llaliplgrlgtpeevadavlflasd--------------------------------------------
00532861   1/1  llkliplgrlgtpeevadavlflasd--------------------------------------------
00380681   1/1  lealldliplgrlgtpedvaea------------------------------------------------
00519651   1/1  lalillplgrlgtpedvadavlfla---------------------------------------------
00515421   1/1  ..........plgrlgtpeeva------------------------------------------------
00529881   1/1  llllllleelleallaliplgrllgtpe------------------------------------------
00368061   1/1  llelllaliplgrlgtpeevae------------------------------------------------
00369221   1/1  plgrlgtpeevaeavlflalsdeas---------------------------------------------
00503831   1/1  dTpllrgllllpeelleallaliplg--------------------------------------------
00425051   1/1  lgrlgtpeevadavlflasdaa------------------------------------------------
00498451   1/1  rlgtpedvadavlflasd..sy------------------------------------------------
00517021   1/1  grlgtpeevaeavlflasdeasyitg--------------------------------------------
00451531   1/1  leallaliplgrlgtpeevaea------------------------------------------------
00500221   1/1  peevadavlflasdeasyitgqvlv---------------------------------------------
00361941   1/1  liplgrlgtpedvaeavlflas------------------------------------------------
00409101   1/1  eelleallaliplgrlgtpeev------------------------------------------------
00499421   1/1  rlgtpeevadavlflasdeasyitg---------------------------------------------
00417571   1/1  alllglldpelleallalipl-------------------------------------------------
00523681   1/1  lgrlgtpeevadavlflasdaasyitgq------------------------------------------
00354711   1/1  llevlgdgiplgrlgtpedvad------------------------------------------------
00532661   1/1  allkliplgrlgtpedvadavlfla---------------------------------------------
00388141   1/1  plgrlgtpeevaeavlflasdda-----------------------------------------------
00387701   1/1  ldgiplgrlgtpedvaeavlfl------------------------------------------------
00499431   1/1  lleallkliplgrlgtpeevadavlfl-------------------------------------------
00482431   1/1  dTpll.....lpeelleallaliplgrll-----------------------------------------
00424291   1/1  laliplgrlgtpedvadavlfl------------------------------------------------
00416101   1/1  aliplgrlgtpeevaeavlfla------------------------------------------------
00510931   1/1  e...........iplgrlgtpe------------------------------------------------
00413661   1/1  iplgrlgtpeevaeavlflasd------------------------------------------------
00385451   1/1  lgrlgtpeevaeavlflasdea------------------------------------------------
00512791   1/1  aliplgrlgtpeevadavlfla------------------------------------------------
00416921   1/1  aeavlflasdaasyitgqvlvvdgGlll------------------------------------------
00474701   1/1  vleallaliplgrlgtpedvadavlfl-------------------------------------------
00398711   1/1  lealldgiplgrlgtpedvaea------------------------------------------------
00489491   1/1  lleallkliplgrlgtpeevadavlflasd----------------------------------------
00519551   1/1  ......plgrlgtpeevaeavlflasdea-----------------------------------------
00486141   1/1  tpedvaeavlflasdaaslyit------------------------------------------------
00512601   1/1  .......lgrlgtpedvaeavlfla---------------------------------------------
00528731   1/1  eellealldliplgrlgtpedvaeavlf------------------------------------------
00506551   1/1  rslalelllllapkgirvnavaPGlvd-------------------------------------------
00436781   1/1  .eellealldliplgrlgt---------------------------------------------------
00353051   1/1  eallaliplgrlgtpeevaeav------------------------------------------------
00482861   1/1  larelllllapkgirvnavaPglvdt--------------------------------------------
00385591   1/1  tpedvaeavlflasdeasyitg------------------------------------------------
00513551   1/1  llrgl..................All--------------------------------------------
00527441   1/1  aellariplgrl.tpedvaravlfllsd------------------------------------------
00512031   1/1  alllllllalallllaallaaa------------------------------------------------
00511091   1/1  ......................------------------------------------------------
00490261   1/1  el...girvtilrpgnvygpglrpl---------------------------------------------
00468971   1/1  nvygpggrp.gnllplllraalagk---------------------------------------------
00482931   1/1  lvtsllplflrlalaglpltlvlgd---------------------------------------------
00507211   1/1  nvygpglgfpgnllplllraalag----------------------------------------------
00498641   1/1  plgalggllplllraalgkgep------------------------------------------------
00460341   1/1  ggpgnllplllraalaglplpvlgd---------------------------------------------
00495191   1/1  lvtsllplflrlalaggplplvlgd---------------------------------------------
00493571   1/1  rpgnvygpglrplgvtgsllplllr---------------------------------------------
00511831   1/1  larelap.glrvvilrpgnvyg------------------------------------------------
00494281   1/1  ----------------------------------------------------------------------
00491171   1/1  gnllplllraalaglpltvlgdgdq---------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00433371   1/1  liplllrlalggepltvlgdgd------------------------------------------------
00532871   1/1  lggllllgdgdalrsfisvedvada---------------------------------------------
00514911   1/1  ----------------------------------------------------------------------
00465741   1/1  pllgelllgvpdsllplflraa------------------------------------------------
00464721   1/1  irlallaalaglpvltvlgdgdq-----------------------------------------------
00462911   1/1  gvtskviplliraalkgkplpi------------------------------------------------
00400431   1/1  Gpggrpe.sliplllraalkgg------------------------------------------------
00419991   1/1  pgnvyGpggrp.glpsgvlpll------------------------------------------------
00371281   1/1  alagepltlvlgdgdqlrdfih------------------------------------------------
00430411   1/1  alkggpllilgdgdakrdfvhv------------------------------------------------
00527221   1/1  llllgdgdakrspisvddvara------------------------------------------------
00519911   1/1  llgdgdakrrpisvedvaravv------------------------------------------------
00383241   1/1  lpvvilrpgnvyGpggspllge------------------------------------------------
00465291   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00430421   1/1  lkggpllilgdgdqkrdfihv-------------------------------------------------
00485161   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00519251   1/1  ----------------------------------------------------------------------
00479651   1/1  ----------------------------------------------------------------------
00521161   1/1  pgdrpngvtgsviplliraalgkge---------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00348721   1/1  ----------------------------------------------------------------------
00516961   1/1  aralvaalldpaaa..gkvynlggpevls-----------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00471781   1/1  glrslisvddvAaalvlaledp.-----------------------------------------------
00519961   1/1  ----------------------------------------------------------------------
00491981   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00484551   1/1  ----------------------------------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00360071   1/1  ----------------------------------------------------------------------
00429061   1/1  ----------------------------------------------------------------------
00405511   1/1  ----------------------------------------------------------------------
00530191   1/1  ----------------------------------------------------------------------
00482701   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00456451   1/1  ----------------------------------------------------------------------