[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF08950.1


[Show Plain Result]

## Summary of Sequence Search
   1::114
  24::114  2.7e-39 65.9% 0051091 00510911 1/1   like                                    
  22::102    8e-36 69.1% 0043818 00438181 1/1   like                                    
   1::114


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGGYSRPAGQLGYNSGQTNKESLMARMVHCIKLNKEAEGLDFPPLPGDLGKKIWQNVSKEAWAGWLKHQT
00510911   1/1  -----------------------martvfCvklkkeaegldfppyPgelGkriyenvskeaWaeWlelqt
00438181   1/1  ---------------------spmartvfCvklkkeaegldfppyPGelGkriyenvskeaWkeWlkhqt


                         -         -         *         -         -         -         -:140
query           MLINENRLNMADPRARQYLIKQTEKYFFGDGADQAAGYVPPPAA--------------------------
00510911   1/1  mliNekrLnlldpearklleeemekflfgegaekaegyvppdee--------------------------
00438181   1/1  mlinekrlnlldpearklleeemekflfgega--------------------------------------