[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF09080.1


[Show Plain Result]

## Summary of Sequence Search
   1::264
   1::259  5.5e-87 44.5% 0051568 00515681 1/1   )-binding Rossmann-fold domains         
   4::263  1.1e-81 42.4% 0050365 00503651 1/1   )-binding Rossmann-fold domains         
   5::263  6.9e-79 43.8% 0050967 00509671 1/1   )-binding Rossmann-fold domains         
   1::262  1.7e-78 46.6% 0046592 00465921 1/1   )-binding Rossmann-fold domains         
   6::262  1.3e-77 43.5% 0047681 00476811 1/1   )-binding Rossmann-fold domains         
   5::259  2.2e-77 44.1% 0051511 00515111 1/1   )-binding Rossmann-fold domains         
   6::262  6.4e-77 43.5% 0049902 00499021 1/1   )-binding Rossmann-fold domains         
   1::263  1.6e-76 43.8% 0050776 00507761 1/1   )-binding Rossmann-fold domains         
   6::265  1.7e-76 45.5% 0042131 00421311 1/1   )-binding Rossmann-fold domains         
   1::262  2.9e-76 44.1% 0038342 00383421 1/1   )-binding Rossmann-fold domains         
   1::262  4.3e-76 42.8% 0045076 00450761 1/1   )-binding Rossmann-fold domains         
   1::265  7.3e-76 43.8% 0037662 00376621 1/1   )-binding Rossmann-fold domains         
   7::262  9.3e-75 45.0% 0048361 00483611 1/1   )-binding Rossmann-fold domains         
   1::262  1.4e-74 45.4% 0038042 00380421 1/1   )-binding Rossmann-fold domains         
   1::262  1.5e-74 45.1% 0051763 00517631 1/1   )-binding Rossmann-fold domains         
   1::263  1.8e-74 44.4% 0047124 00471241 1/1   )-binding Rossmann-fold domains         
   3::265  3.5e-74 44.5% 0052529 00525291 1/1   )-binding Rossmann-fold domains         
   1::263  5.2e-74 43.4% 0051006 00510061 1/1   )-binding Rossmann-fold domains         
   3::263  6.1e-74 42.2% 0043703 00437031 1/1   )-binding Rossmann-fold domains         
   5::263  1.1e-73 42.6% 0051440 00514401 1/1   )-binding Rossmann-fold domains         
   7::263  1.1e-73 43.3% 0038068 00380681 1/1   )-binding Rossmann-fold domains         
   5::263  1.5e-73 45.1% 0053286 00532861 1/1   )-binding Rossmann-fold domains         
   1::263  2.6e-73 43.6% 0050237 00502371 1/1   )-binding Rossmann-fold domains         
   1::260  2.6e-73 46.0% 0050955 00509551 1/1   )-binding Rossmann-fold domains         
   2::266  7.9e-73 42.4% 0035018 00350181 1/1   )-binding Rossmann-fold domains         
   3::262  9.7e-73 44.0% 0051965 00519651 1/1   )-binding Rossmann-fold domains         
   2::262  1.1e-72 46.3% 0040910 00409101 1/1   )-binding Rossmann-fold domains         
   8::262  1.1e-72 45.7% 0042505 00425051 1/1   )-binding Rossmann-fold domains         
   3::263  1.4e-72 42.7% 0039871 00398711 1/1   )-binding Rossmann-fold domains         
   7::262  1.4e-72 46.9% 0046483 00464831 1/1   )-binding Rossmann-fold domains         
   1::262  1.8e-72 45.6% 0051542 00515421 1/1   )-binding Rossmann-fold domains         
   4::264  1.9e-72 45.3% 0036806 00368061 1/1   )-binding Rossmann-fold domains         
   2::261  2.7e-72 43.1% 0039438 00394381 1/1   )-binding Rossmann-fold domains         
   1::262  3.6e-72 43.8% 0035471 00354711 1/1   )-binding Rossmann-fold domains         
   2::265  6.4e-72 44.9% 0052988 00529881 1/1   )-binding Rossmann-fold domains         
   1::264  6.8e-72 45.8% 0049943 00499431 1/1   )-binding Rossmann-fold domains         
   3::265  9.8e-72 44.8% 0052368 00523681 1/1   )-binding Rossmann-fold domains         
   1::263    1e-71 44.0% 0052085 00520851 1/1   )-binding Rossmann-fold domains         
   3::263  1.4e-71 45.9% 0053266 00532661 1/1   )-binding Rossmann-fold domains         
   2::258  1.7e-71 43.7% 0041757 00417571 1/1   )-binding Rossmann-fold domains         
   5::263  2.3e-71 44.6% 0050383 00503831 1/1   )-binding Rossmann-fold domains         
   2::263  6.8e-71 44.4% 0041610 00416101 1/1   )-binding Rossmann-fold domains         
   2::262  8.6e-71 45.3% 0051279 00512791 1/1   )-binding Rossmann-fold domains         
   2::265  1.2e-70 44.2% 0038770 00387701 1/1   )-binding Rossmann-fold domains         
   5::262  1.8e-70 46.8% 0051093 00510931 1/1   )-binding Rossmann-fold domains         
   5::266    2e-70 42.7% 0045153 00451531 1/1   )-binding Rossmann-fold domains         
   7::262  3.4e-70 45.5% 0036922 00369221 1/1   )-binding Rossmann-fold domains         
   3::262  3.9e-70 45.3% 0038545 00385451 1/1   )-binding Rossmann-fold domains         
   2::262  4.7e-70 46.4% 0041366 00413661 1/1   )-binding Rossmann-fold domains         
   1::263  8.3e-70 46.5% 0042429 00424291 1/1   )-binding Rossmann-fold domains         
   3::263  8.7e-70 46.1% 0036194 00361941 1/1   )-binding Rossmann-fold domains         
   3::260  1.3e-69 45.6% 0038814 00388141 1/1   )-binding Rossmann-fold domains         
   4::260  2.2e-69 42.7% 0047470 00474701 1/1   )-binding Rossmann-fold domains         
   3::256  2.5e-69 44.9% 0043678 00436781 1/1   )-binding Rossmann-fold domains         
   5::265  4.2e-69 42.9% 0052873 00528731 1/1   )-binding Rossmann-fold domains         
   1::262    6e-69 46.4% 0050022 00500221 1/1   )-binding Rossmann-fold domains         
   3::263  7.6e-69 46.9% 0051702 00517021 1/1   )-binding Rossmann-fold domains         
   3::262  1.5e-68 44.5% 0035305 00353051 1/1   )-binding Rossmann-fold domains         
   4::265  1.6e-68 48.3% 0041692 00416921 1/1   )-binding Rossmann-fold domains         
   3::264  2.3e-68 46.3% 0049942 00499421 1/1   )-binding Rossmann-fold domains         
   5::263  4.9e-68 44.9% 0051355 00513551 1/1   )-binding Rossmann-fold domains         
   7::262  5.2e-68 47.8% 0049845 00498451 1/1   )-binding Rossmann-fold domains         
   7::263    9e-68 48.0% 0046801 00468011 1/1   )-binding Rossmann-fold domains         
   3::263  9.5e-68 45.5% 0048949 00489491 1/1   )-binding Rossmann-fold domains         
   5::262  1.2e-67 45.4% 0051260 00512601 1/1   )-binding Rossmann-fold domains         
   7::265  6.5e-67 45.0% 0048243 00482431 1/1   )-binding Rossmann-fold domains         
   8::266  6.3e-66 44.8% 0051955 00519551 1/1   )-binding Rossmann-fold domains         
   4::263  8.9e-66 44.7% 0048286 00482861 1/1   )-binding Rossmann-fold domains         
   6::262    1e-65 48.0% 0048614 00486141 1/1   )-binding Rossmann-fold domains         
   6::262  1.1e-64 50.2% 0038559 00385591 1/1   )-binding Rossmann-fold domains         
   6::264  1.4e-64 45.3% 0050655 00506551 1/1   )-binding Rossmann-fold domains         
   5::259  2.4e-61 46.4% 0051109 00511091 1/1   )-binding Rossmann-fold domains         
   5::259  8.3e-61 41.2% 0051203 00512031 1/1   )-binding Rossmann-fold domains         
   5::265  1.3e-59 43.1% 0052744 00527441 1/1   )-binding Rossmann-fold domains         
   1::192  6.4e-54 48.6% 0048035 00480351 1/1   )-binding Rossmann-fold domains         
   5::261  2.2e-46 35.0% 0050721 00507211 1/1   )-binding Rossmann-fold domains         
   8::262  5.6e-46 35.0% 0049026 00490261 1/1   )-binding Rossmann-fold domains         
   8::262  4.5e-45 31.5% 0049864 00498641 1/1   )-binding Rossmann-fold domains         
   7::262  5.1e-45 36.2% 0046034 00460341 1/1   )-binding Rossmann-fold domains         
   8::262  6.2e-45 34.0% 0048293 00482931 1/1   )-binding Rossmann-fold domains         
   8::262  1.6e-44 35.8% 0046897 00468971 1/1   )-binding Rossmann-fold domains         
   8::262  6.6e-44 33.6% 0049519 00495191 1/1   )-binding Rossmann-fold domains         
   5::262  3.1e-42 35.6% 0049357 00493571 1/1   )-binding Rossmann-fold domains         
   1::262  4.2e-41 33.1% 0046574 00465741 1/1   )-binding Rossmann-fold domains         
   1::259  9.7e-41 30.5% 0051183 00511831 1/1   )-binding Rossmann-fold domains         
   5::262  9.8e-41 31.8% 0053287 00532871 1/1   )-binding Rossmann-fold domains         
   1::162  1.1e-39 46.0% 0047965 00479651 1/1   )-binding Rossmann-fold domains         
   1::162  4.2e-38 37.9% 0046529 00465291 1/1   )-binding Rossmann-fold domains         
   8::262  5.6e-38 31.6% 0051491 00514911 1/1   )-binding Rossmann-fold domains         
   8::259  6.1e-37 31.7% 0043337 00433371 1/1   )-binding Rossmann-fold domains         
   8::262  1.1e-36 34.7% 0049117 00491171 1/1   )-binding Rossmann-fold domains         
   1::260  3.6e-36 31.5% 0046472 00464721 1/1   )-binding Rossmann-fold domains         
   9::262  2.2e-35 29.3% 0037128 00371281 1/1   )-binding Rossmann-fold domains         
   6::240  9.2e-34 31.1% 0049428 00494281 1/1   )-binding Rossmann-fold domains         
   5::262  1.1e-33 31.0% 0052722 00527221 1/1   )-binding Rossmann-fold domains         
   8::259  1.6e-32 26.3% 0041999 00419991 1/1   )-binding Rossmann-fold domains         
   1::259  1.7e-32 29.9% 0040043 00400431 1/1   )-binding Rossmann-fold domains         
   5::262  2.7e-32 31.0% 0051991 00519911 1/1   )-binding Rossmann-fold domains         
   8::262  2.7e-32 26.2% 0046291 00462911 1/1   )-binding Rossmann-fold domains         
   6::204  1.4e-31 37.4% 0036785 00367851 1/1   )-binding Rossmann-fold domains         
   1::259  1.8e-30 29.1% 0043041 00430411 1/1   )-binding Rossmann-fold domains         
   1::259  1.3e-29 27.4% 0038324 00383241 1/1   )-binding Rossmann-fold domains         
   2::186  1.7e-29 41.7% 0048516 00485161 1/1   )-binding Rossmann-fold domains         
   5::177    2e-28 31.6% 0042180 00421801 1/1   )-binding Rossmann-fold domains         
   1::157  7.2e-28 37.0% 0034872 00348721 1/1   )-binding Rossmann-fold domains         
   8::189  5.6e-27 36.8% 0048186 00481861 1/1   )-binding Rossmann-fold domains         
   8::262  1.4e-25 25.9% 0051925 00519251 1/1   )-binding Rossmann-fold domains         
   1::262  2.3e-24 26.8% 0043042 00430421 1/1   )-binding Rossmann-fold domains         
   8::168  4.4e-24 38.9% 0038784 00387841 1/1   )-binding Rossmann-fold domains         
   1::120  3.4e-23 38.1% 0035290 00352901 1/1   )-binding Rossmann-fold domains         
   5::168    1e-22 31.5% 0049686 00496861 1/1   )-binding Rossmann-fold domains         
   5::166  5.8e-21 37.4% 0035477 00354771 1/1   )-binding Rossmann-fold domains         
   1::262  5.9e-21 27.2% 0052116 00521161 1/1   )-binding Rossmann-fold domains         
   6::262  3.4e-19 29.3% 0051696 00516961 1/1   )-binding Rossmann-fold domains         
   5::260  5.2e-19 29.4% 0047178 00471781 1/1   )-binding Rossmann-fold domains         
   5::176  9.1e-17 30.7% 0048414 00484141 1/1   )-binding Rossmann-fold domains         
   5::144  1.9e-16 28.8% 0048455 00484551 1/1   )-binding Rossmann-fold domains         
   2::141  2.1e-13 35.2% 0040551 00405511 1/1   )-binding Rossmann-fold domains         
   7::198  9.9e-13 27.6% 0050228 00502281 1/1   )-binding Rossmann-fold domains         
   2::144  2.1e-11 22.5% 0042906 00429061 1/1   )-binding Rossmann-fold domains         
   5::169  6.1e-11 30.1% 0037437 00374371 1/1   )-binding Rossmann-fold domains         
   2::262  8.1e-11 24.4% 0049198 00491981 1/1   )-binding Rossmann-fold domains         
   8::169  1.2e-10 25.5% 0036007 00360071 1/1   )-binding Rossmann-fold domains         
   8::262    2e-10 26.2% 0051996 00519961 1/1   )-binding Rossmann-fold domains         
   1::146  4.7e-07 32.4% 0042340 00423401 1/1   )-binding Rossmann-fold domains         
   6::249  8.1e-07 26.9% 0053019 00530191 1/1   )-binding Rossmann-fold domains         
   5::170  2.7e-05 25.9% 0045621 00456211 1/1   )-binding Rossmann-fold domains         
   2::159  3.6e-05 24.6% 0036746 00367461 1/1   )-binding Rossmann-fold domains         
   5::74   5.1e-05 36.4% 0047032 00470321 1/1   )-binding Rossmann-fold domains         
   8::149  8.8e-05 20.6% 0048227 00482271 1/1   )-binding Rossmann-fold domains         
   5::79   0.00021 40.8% 0042342 00423421 1/1   )-binding Rossmann-fold domains         
   1::77   0.00065 25.0% 0042534 00425341 1/1   )-binding Rossmann-fold domains         
   1::264


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGNALQGRHALVTGGGRGIGAAIARRLLADGASVTLLGREQAALDATVHALQSCVIEGAALGAVSADITD
00515681   1/1  m..dlkgkvalvTGassgiGlaiAralaaaGarVvltdrneekleelaaeleal...ggrvlavalDvtd
00503651   1/1  ---slkgkvalvtGassgiGlaiAralaeeGakVvltdrneekleelaaeleal...ggkvlavalDvtd
00509671   1/1  ----dlkgkvalvTGassgiGlaiAralaaeGarVvltdrneekleelaaelealglpsgrvlavalDvt
00465921   1/1  mlldlkgkvalvtGaanssgiGraiAralaaeGarVvltdrneealeelaaeleaalpssllleleelle
00476811   1/1  -----kgkvalvTGassGiGlaiAralaaaGarlllVvltdrneekleelaaelrallpsggrvlavalD
00515111   1/1  ----LkgkvalvTGAssGiGraiAralaalleegarVvlvarneekleelaaeleallp.ggrvlavalD
00499021   1/1  -----kgkvalvtGasnesgIGraiAlalaeeGakVvltdrneealeelaaelealldeslllslellle
00507761   1/1  m...lkgkvalvTGassgiGlaiAralaaeGarVvltdlrneekleelaaelleal..ggrvlavalDvt
00421311   1/1  -----kgkvalvTGassgiGraiAralaaeGarVvltdrnseekleelaaeleall..ggralavalDvt
00383421   1/1  pslslkgkvalvTGasgGiGralaralaarGarVvlldrsglssllllsaekleelaael......ggrv
00450761   1/1  llvlllllllllslkgkvalvTGassgiGraiaralaaaGarVvlldrsseekleelaaeleal...ggr
00376621   1/1  llllmllslkgkvalvTGassgiGraiAralaaaGarVvltdrneekleelaaeleal...ggrvlaval
00483611   1/1  ------GkvalvtGasnesgiGraiAlalaeeGakVvitdrneealeelaaeleallseellleleelle
00380421   1/1  mmlslkgkvalvTGassGiGlaiaralaaaGarVvlldrneekleelaaeleall..ggrvlavalDvtd
00517631   1/1  m.ldlkgkvalvtGassgiGlaiaralaaaGarVvlldrneekleelaae........grvlavalDvtd
00471241   1/1  llmllslkgkvalvTGassGiGlaiAralaaaGarVvltdrseekleelaaeleal..lggrvlavalDv
00525291   1/1  --gdlsgkvalvtGassgiGlaiAralaaeGarVvltdrne..leelaaeleal...ggrvlavalDvtd
00510061   1/1  ms..lkgkvalvTGassgiGlaiAralaaeGarVvltdrneekleelaaelealglpsgrvlavalDvtd
00437031   1/1  --mdlkgkvalvtGassGiGraiAralaaeGarVvltdrneekleelaaelrallplggrvlavalDvtd
00514401   1/1  ----gsslldmldlkgkvalvTGasggiGraiAralaaaGarVvlldrneekleelaaeleaelplllgg
00380681   1/1  ------gkvalvTGasggiGlaiaralaaeGarVvlldrneekleelaaeleal...ggrvlavalDvtd
00532861   1/1  ----sdmldlkgkvalvtGassgiGlaiAralaeeGakVvltdrneekleelaaeleal...ggkvlava
00502371   1/1  m..dlkgkvalvtGassgiGlaiAralaaaGarVvltdrnaekleelaaelle..alggrvlavalDvtd
00509551   1/1  lllmlldlkgkvalvTGassgiGlaiAralaaaGarVvlldrneekleelaaeleallp.ggrvlavalD
00350181   1/1  -mmdlkgkvalvTGassgiGlaiaralaaaGarVvlldrneekleelaaelral...ggrvlavalDvtd
00519651   1/1  --smdlkgkvalvTGassgiGlaiAralaaaGarVvltdrneekleelaaelea....ggrvlavqlDvt
00409101   1/1  -mmdlkgkvalvTGassgIGlaiaralaaeGarvvlldrneekleelaaeleal..pggrvlavalDvtd
00425051   1/1  -------kvalvTGassgiGraiAlalaaeGarVvltdrneealeela.........ggkalavalDvtd
00398711   1/1  --mdlkgkvalvTGassgiGraiaralaaaGarVvlldrneekleelaael......ggrvlavalDvtd
00464831   1/1  ------sgkvalvTGassGiGlaiAralaaeGakVvlltdrneekleelaeeleall..ggkvlavalDv
00515421   1/1  mmldlkgkvalvTGassGiGraiAralaarGarVvladrseelaeleagleklealaeel...ggrvlav
00368061   1/1  ---dlkgkvalvTGassgiGlaiAralaaaGarVvlldrneekleelaael......ggrvlavalDvtd
00394381   1/1  -mmslkgkvalvTGassgiGraiaralaaaGarVvltdrsgeekleelaaeleal...ggrvlavalDvt
00354711   1/1  Ms..lkgkvvlvTGasggiGralaralaaaGarVvlldrseekleelaael......ggrvlavalDvtd
00529881   1/1  -llslkgkvalvtGasselgiGlaiAralaaeGarVvltdrneealeelaaele.....ggralavalDv
00499431   1/1  lmlldlkgkvalvtGAagssgiGlaiAralaeeGakVvltdrneekleelaeeleel...g.kvlavalD
00523681   1/1  --dllkgkvalvtGassgiGlaiaralaeeGakVvltdrnee.leelaeel........kvlavalDvtd
00520851   1/1  llsllsllkgkvalvtGassgiGlaiAralaaaGarVvltdrsaekleelaaeleal...ggrvlavalD
00532661   1/1  --gslkgkvalvtGAaGssgiGlaiAralaeeGakVvltdrneekleela.ella...lggkvlavalDv
00417571   1/1  -mmdlkgkvalvTGAssGiGraiAralaalleeGarvvltarneekleelaaeleall.pggrvlavalD
00503831   1/1  ----lllllllllllllldlllslldlkgkvalvTGasgGiGraiAralaaaGarVvlldrneekleela
00416101   1/1  -mmslkgkvalvTGassgiGlaiAralaaeGarVvltdrneekleelaaelea....ggrvlavalDvtd
00512791   1/1  -lldlkgkvalvTGassgiGlaiAralaaaGarVvlldrneekleelaaelg.......rvlavalDvtd
00387701   1/1  -mmdlkgkvalvTGasggiGlaiaralaaeGarVvlldrneekleelaael......ggrvlavalDvtd
00510931   1/1  ----llllmlldlkgkvalvTGassGiGraiAralaaaGarVvltarneekleelaaelralggd..rvl
00451531   1/1  ----psllslkgkvalvTGassgiGlaiAralaaaGarVvltdrneekleelaaeleal...ggrvlava
00369221   1/1  ------gkvalvTGassgiGlaiAralaaaGarVvlldrsgaekleelaaeleal...ggrvlavalDvt
00385451   1/1  --ldlkgkvalvTGasggiGlaiAralaaaGarVvlldrseekleelaael......ggrvlavalDvtd
00413661   1/1  -mmdlkgkvalvtGassgiGlaiaralaaeGarVvlldrneekleelaael......ggrvlavalDvtd
00424291   1/1  mmlslkgkvvlvtGasggiGralaralaaaGarVvlldrseekleelaaelg.......rvlavvlDvtd
00361941   1/1  --mdlkgkvalvtGasggiGraiaralaaaGarVvlldrneekleelaaelg.......rvlavvlDvtd
00388141   1/1  --ldlkgkvalvTGassgiGraiaralaarGarVvlldrseekleelaael......ggrvlavalDvtd
00474701   1/1  ---dlkgkvalvtGassgiGlaiAralaaeGarVvltdrneekleelaaelealggka.rvlavalDvtd
00436781   1/1  --mdlkgkvalvTGassgiGlaiAralaaaGarVvlldrseekleelaael......ggrvlavalDvtd
00528731   1/1  ----lkgkvalvTGassgiGlaiaralaaeGarVvlldrneekleelaaeleall.pggrvlavalDvtd
00500221   1/1  lllslkgkvalvTGassgiGlaiAralaaeGarVvlldrseeale..............rvlavalDvtd
00517021   1/1  --ldlkgkvalvtGassgiGlaiAralaaaGarVvlldrseekleelaael......ggrvlavalDvtd
00353051   1/1  --mdlkgkvalvTGassGIGlaiAralaarGarvvlldrneekleelaaelral..pggrvlavalDvtd
00416921   1/1  ---dlkgkvalvtGassgiGraiaralaaeGarVvltarneekle............ggralavvlDvtd
00499421   1/1  --ldlkgkvalvtGassgiGlaiaralaaaGarVvlldrseekleelaael........rvlavalDvtd
00513551   1/1  ----lkgkvalvTGasggiGlaiaralaeeGdlakVvlldrneekleelaael......ggrvlfvqlDv
00498451   1/1  ------gkvalvTGassgiGralaralaarGarVvlldrsee...............ggrvlavaaDvtd
00468011   1/1  ------gkvalvTGassgiGraiaralaaaGarVvlldrneek....................vqlDvtd
00489491   1/1  --gllkgkvalvtGAagssgiGlaiAralaeeGakVvltdrn.ekleelaeelea...aggkvlavalDv
00512601   1/1  ----sdmslkgkvalvTGasggiGlalAralaarGarVvlldrseekleelaaeleal...ggrvlvval
00482431   1/1  ------lpvalvTGassGiGlaiAralaaaGarVvltdrlneekleelaaelral..pggrvlavalDvt
00519551   1/1  -------kkvalvtGassgiGlaiAralaeeGarlllleeeVvltdrneekleelaaeleal...ggkvl
00482861   1/1  ---mlkgkvvlvTGassGiGlalaralaarGasrVvlldrneekleelaaeleal...ggrvlfvqlDvt
00486141   1/1  -----kgkvvlvtGgsggiGsalaralaaeGakvvlvdrseealae...........gggalavaaDvtd
00385591   1/1  -----egkvvLVtGgsggiGraiaralaaaGarVvvvdrseeal.............gggvlavaaDvtd
00506551   1/1  -----sGmkvalvTGassgiGlaiaralaealGakVvltdrneekleelaaeleal...ggrvlfvalDv
00511091   1/1  ----sslsllldmlslkgkvalvTGasggiGralaralaarGarVvlldrseekleelaaelealg..gg
00512031   1/1  ----dslsllslkgkvalvTGassGiGraiAralaeeGarVvltdrneekleelaaelealg..ggkvla
00527441   1/1  ----amdlgllsgkvvlvTGasggiGralaralaarGarvVvlldrsglleekleelaaeleal...ggr
00480351   1/1  gllldtallvllllllllldlkgkvalVtGasggiGlaiAralaaaGarVvladrneeklealaaelgal
00507211   1/1  ----ldmmslmgktvlvTGatGgiGsalaraLlarGaeVvlldrspekleelaaelea...lg.gvefvq
00490261   1/1  -------ktvlvTGatGgiGsalaraLlarGaeVvaldrspeklealaaeleall.pllllfellgllde
00498641   1/1  -------krvLvTGgtGfiGsalaraLlerGaevvvldrseekleelleeleall..ggrvefvegDltd
00460341   1/1  ------gktvlvTGatGgiGsalaraLlarpGaeVvaldrltsagspeklealaael........gvefv
00482931   1/1  -------nktvlvTGatGgiGsalaraLlarGaeVvlldrlssgaseekleelaaelraaggp..gvefv
00468971   1/1  -------ktvlvTGatGgiGsalaraLlarpGaeVvaldrlsspeklealaallgal.....gvefvqgD
00495191   1/1  -------rktvlvTGatGgiGsalaraLlarGaeVvlldrlssglspekleell..aellealgggvefv
00493571   1/1  ----llsllsslldllslkgktvlvTGatGgiGsalaraLlarGaeVvlldrspekleelaaelealggs
00465741   1/1  M.....gktvlvTGatGgiGsalaraLlarGaeVvlldrspsslllllekleelaaelea...lgggvef
00511831   1/1  llllmmmslegktvLVTGAtGfiGsalvrrLlerGyeVvaldrspekleelaallealggdp.gvelvvg
00532871   1/1  ----lsgktvlVtGAtGgiGsalvrrLleagdvaevvalvrspekleel..........gggvevvvgDl
00479651   1/1  GkplvlggslgrseatgygvvysllaalkrllmglslegkvvlVtGaG.giGraiarrlaaeGakVvvtd
00465291   1/1  PctplgvllllellgillllllmmlrlkgkvalVtGassgiGralAllLareGatVvvvdrneekleela
00514911   1/1  -------SKtvlvTGatGgiGsalaraLlerGaeVvlldrspekleellaeleall..gggvefvqgDlt
00433371   1/1  -------ktvLVTGatGfiGsalaraLlerGyrVvaldrdpekleellaeleal...gggvefvegDltd
00491171   1/1  -------ktvlvTGatGgiGsalaraLlallllslaGaevvaldrspseealealael.....lalggve
00464721   1/1  M.....gktvlvtGatGfiGsalaraLlarGaveVvaldrspe........................Dlt
00371281   1/1  --------kvlVTGgaGfiGsalvraLlerGyeevvvldrlesgakl...........gpgvefvegDlt
00494281   1/1  -----emktvlitGAnRGiGlelvkqllelakrgllviataRdpekae....eleelaaegsnlvilqld
00527221   1/1  ----llllkillslkgkkvlvtGAtGgiGralvkellargavskvialvRrpekleelaae.........
00419991   1/1  -------kkvLvTGgtGfiGshlaraLlerGaevvvldrlsegaeellaeleal...gprvefvkgDltd
00400431   1/1  M.....gkkvLvTGgtGfiGsalvraLlerGaevvvldrdpegaaellallealg..gprvefvagDltd
00519911   1/1  ----lllllllimmmlkgkkvlvtGAtGgiGralvkeLlergavskVtalvRrpekleelaae.......
00462911   1/1  -------skkvLvTGatGfiGsalvrrLlerGyeVialdrlssgsneekleellkele...llgpgvefv
00367851   1/1  -----kgkkvlviGa.GgiGralaraLaeaGaevtvadrslekaealaael......g.gveavelDvtd
00430411   1/1  M....sgkkvlvtGAtGfiGshlaraLleaGhevvalvRspekaalalalelleelaa.....pgvevve
00383241   1/1  M.....gkrvLvTGgtGfiGshlvraLlerpGhevvvldrlpsgadallellalltlllsllekllllle
00485161   1/1  -lsleeaAalplagltaylallllldlagllpgktvlvtGAaggiGsaaaqllaalGarViavdrseekl
00421801   1/1  ----DgigavsllkrllvdlpgkkvlvlGaG.giGralalalaaagaevvvvnrtlekaeelaeelga..
00348721   1/1  fhpinvgdlvtgllfdnllpctpsgvlellkatgidlaGkvavVtGasrgiGraiallLaaagatVtvcd
00481861   1/1  -------kkvlvtGAsGgiGsalalllaargaevvlldrspeklegvaldl.....sdlgvevvvadltd
00519251   1/1  -------kkkilvtGatGfiGsalaraLlergyevialdrspekleellkll.........vefvkgDlt
00430421   1/1  M....kgmkvlvtGgtGfiGshlvraLleaGhevvvlvRnpskgkaaklelleellglg.vevvegDltd
00387841   1/1  -------kkvlvtGAsGgiGsalalllakegaevvlvdrdeekalealagelldlgg...galvlvadvt
00352901   1/1  fgalnlgrlllgllglvpctplgilellerlgidlsgkvalVtGasggiGraiallLaraGatVtvtdrn
00496861   1/1  ----AasilllgltsylallevlkikegkkVlvtGAtGgiGlavvrlllkrGykViaidrseekleklke
00354771   1/1  ----MlkgmkvlVtGAaGgiGsalalrlaarglagldllvevvlldrsealealegvaldlsd......g
00521161   1/1  MslllllllllmlkgmkilVTGaaGfiGshlvrrLlerGyevvaldrspekleelld.........pgve
00516961   1/1  -----kgkrvlvtGAtGfiGshlvrrLlaeghvsevvalvrrpsk.............llpgvevvvgDl
00471781   1/1  ----mmmmkvlvtGAtGfiGsalvrelleagheVtalvRdpsklaall.........glgvevvvgDltd
00484141   1/1  ----lkgktvliiGaG.gvGlaiaqalaalGakkVvlvdrdeekaqalveqlkelgs.kikvkavsldvg
00484551   1/1  ----DgiGfvellkrlgvdlkgktvlitGAG.gagraialalaklg.nvvianrtlekaealaeelgelg
00405511   1/1  -agllpgktvlvtGa.GgvGlaaaqlaaalGarViavdrseeklelare.......lgad...vvidvtd
00502281   1/1  ------mmkvlitGAtGfiGselvrlLlehgdhevtaldrrtsagkllnep.........gvevvegdlt
00429061   1/1  -aklkpgktvlvtGAaggvGlaaaqlakalGarViatarseeklellke.......lGadvvidykdedl
00374371   1/1  ----agrlavleaalllervltglgalagllpgkrvlViGaG.giGleaAaalarlGakVtvvdrrpell
00491981   1/1  -lnpsemkgkrvlvtGgtGfiGsnlaelLlergyevvgldrsepglnslldll....llaeniafvkgDl
00360071   1/1  -------lellllialenllllllllllellllsllkpmkVlVtGAaGfiGshlalrLlsgglagldqlv
00519961   1/1  -------MkvLvtGatGfiGshlvrrLlerghleVvgldrlssgleelle........lpgvefvegDlt
00423401   1/1  aGylavllaalllcrflgglgllltlagglagkkvlviGaG.gvGlaaarllaalGakVtvldrnpekle
00530191   1/1  -----kmmkvavtGAtGyiGralvrlLlerghpvvalvrlassasa...........gkgvevvlgdltd
00456211   1/1  ----lkplkvlvtGAaGqiGsalalllalggladldlevelvlldivealdalkgvaldlsda......a
00367461   1/1  -lellsvalhallraglvpGktVlviGa.GgiGlaaalaakalGakViatdrspekle...qake....l
00470321   1/1  ----llGdntdglgavellerlggdlkgktvlviGaG.giGravaralaaaGakrvvvanrtpekaeela
00482271   1/1  -------mkiaviGaGy.vGlplAallaeaGheVvgvDideekvealnd..gilpilepgleellrdlld
00423421   1/1  ----ldllplfldlrgkdvlviGgGdv.Glaaarllleagakvtvverrllprlaalaeelgvevvlgd.
00425341   1/1  lsmvlkgkkvaviGaGl.iGlalalllallglgeVvlyDinpekleglaadladilelllvkgrirattd


                         -         -         *         -         -         -         -:140
query           ADWVSGAFAGATEARGPITLLVNNAGQAYSAPFGKTDLALWQRMLEVNLTGTFICTQAALPAMLEAGWGR
00515681   1/1  eesvealveavleefgrldilvnnaGillplgplldlsledfervldvnllgtflltraalplmrkrggg
00503651   1/1  eesvealveeileefgrldilvnnagillpgplldlsledwervldvnllgvflltkaalplllmrkrgg
00509671   1/1  deesvealveevleefgrldilvnnAgialpgpgllldlsledfervldvnllgtflltraalplmlkrg
00465921   1/1  leelleleaaleeleeleggralavaaDvtdeesvealvaaaveefgrldiLvnnagiallllgplldls
00476811   1/1  vtdeesvealveav..efgrldiLvnnAGialpgpleelsledwervldvNllgtflltraalplmrkrg
00515111   1/1  vtdeesvealveavlellleefgrldilvnnAGillplllgplleltledwdrvldvnllgvflltraal
00499021   1/1  lekllellaallelsdleggkalavaaDvtdeesvealvdaivekfgrldiLvnnagiagellgplldls
00507761   1/1  deesvealveevleefgrldilvnnagialpgplldlsledfervldvnllgtflltraalplmrkrggg
00421311   1/1  dealaeeleelelllllllesvealveaalerfgrldilvnnAgialvgallglllllllllkplldlsl
00383421   1/1  lavalDvtdeesvealveaaleefgrldilvnnAgilldgplleltledwervldvnllgtflltraalp
00450761   1/1  vlavalDvtdeesvealveavleefgrldilvnnAgillpgpleelsledfervldvnllgtflltraal
00376621   1/1  Dvtdeesvealveaileefgrldilvnnagillp.pllelsledfervldvnllgvflltraalplmrkr
00483611   1/1  leelleleaaleeledleggkalavaaDvtdeesvealvdaaverfgrldiLvnnagialllggplldls
00380421   1/1  eesvealveaaleefgrldilvnnagillpgplldlsledfervldvnllgtflltraalplmrkrglgg
00517631   1/1  eesvealv....eefgrldilvnnagillvgplldlsledfervldvnllgtflltraalpllrkrgggr
00471241   1/1  tdeesvealveavleefgrldilvnnAgillpgplleltledfervldvnllgvflltraalplmrkrgl
00525291   1/1  eesvealveavleefgrldilvnnagillpgplldlsledfervldvnllgvflltraalpllrkrgggr
00510061   1/1  eesvealveavleefgrldilvnnaGialpgplegslldlsledfervldvnllgtflltraalplmlkr
00437031   1/1  eesvealveavleefgrldilvnnagillpllllgplldlsledfervldvnllgvflltraalpllrkr
00514401   1/1  rvlavalDvtdeesvealveeileefgrldilvnnAgilavgpledlsledfervldvNvlgtflltraa
00380681   1/1  eesvaalveavleefgrldilvnnagillvgplldlsledfervldvnllgtflltraalplmrkrglgg
00532861   1/1  lDvtdeesvealveeileefggrldilvnnagilllgplldlsledwervldvnllgvflltkaalplmr
00502371   1/1  eesvealveavleefgrldilvnnagillpgplldlsledfervldvnllgvflltraalpllrkrgggr
00509551   1/1  vtdeesvaalvaavleefgrldilvnnAgillpgpllelsledwervldvnllgtflltraalplmrkrg
00350181   1/1  eesvealveavleefggrldilvnnagillpgplldltledfervldvnllgtflltraalpllrkrggg
00519651   1/1  deesvealveevleefgrldilvnnAgilgpllgplldlsledfervldvnllgtflltraalplmrkrg
00409101   1/1  elesvealveealeefgridilvnnAGi........lsledwervldvNllgtflltraalplmrkrglg
00425051   1/1  eesvealveaaveefgrldiLvnnagialllgplldlsledwdrvldvnllgvflltraalplmlkrggg
00398711   1/1  eesvealvaavleefgrldilvnnAgillvgplldlsledfervldvnllgtflltraalplmrkrglgg
00464831   1/1  tdllelleleleelleleleesvealveeileefgrldilvnnAGialpgpllllkslllsellgslldl
00515421   1/1  alDvtdeesvaalvaavleefgrldilvnnAGilldgpleeltledwervldvnllgaflltraalplmr
00368061   1/1  eesvealveaaleefgrldilvnnAgillpllllllgplldlsledfervldvnllgtflltraalplmr
00394381   1/1  deesvealveavleefgrldilvnnagillpgplldlsledfervldvnllgtflltraalplmlkr..g
00354711   1/1  eesveaaveavleefggldvlvnnAgillvlllllgpledlsledwervldvNvlgtflltraalplmrk
00529881   1/1  tdeesvealvaaavellgefgrldilvnnagialllllllgplldlsledwdrvldvnllgvflltraal
00499431   1/1  vtdeesvealveeileefgrldilvnnaGiaglslllgplldlsledwervldvnllgvflltkaalplm
00523681   1/1  eesvealveeileefgrldilvnnagilllgplldlsledwervldvnllgvflltkaalplmrkrgggr
00520851   1/1  vtdeesvealveavleefgrldilvnnagillpgplldlsledfervldvnllgtflltraalpllrkrg
00532661   1/1  tdeesvealveeileefgrldilvnnaGiagklellgplldlsledwervldvnllgtflltkaalplm.
00417571   1/1  vtdeesvealveavlellleefgrldilvnnAGillplllgpllelsledwdrvldvnllgvflltraal
00503831   1/1  aeleall..ggrvlavalDvtdeesvealveeileefgrldilvnnAgilavgpledlsledfervldvN
00416101   1/1  eesvealveavleefgrldilvnnagillpgplldltledfervldvnllgtflltraalplmrkrglgg
00512791   1/1  eesvealveavleefgrldilvnnagillvlgplldlsledwervldvnllgtflltraalplmrkrg.g
00387701   1/1  eesvealveavleefgrldilvnnAgialpgplldlsledfervldvnllgtflltraalplmrkrg.gr
00510931   1/1  avalDvtdeesvealveavleefgrldilvnnAgillpgpledltledwervldvNllgvflltraalp.
00451531   1/1  lDvtdeesvealveaileefggrldilvnnagillpgplldltledfervldvnllgvflltraalplmr
00369221   1/1  deesvealvaavleefgrldilvnnagilldgplldltledfervldvnllgtflltraalplmrkrggg
00385451   1/1  eesvealvaealeefgrldilvnnAgillvgplldlsledfervldvnllgtflltraalpllrkrgggr
00413661   1/1  eesvealveavleefgrldilvnnagillpgplldlsledfervldvnllgtflltraalpllrkrgggr
00424291   1/1  eesveaaveel....ggldvlvnnagiallgplldlsledfervldvnllgtflltraalplmrkaglgg
00361941   1/1  eesveaaveel....ggldvlvnnagialpgplldlsledfervldvnllgtflltraalplmrkrglgg
00388141   1/1  eesvaalvaavleefgrldilvnnagvlldgplldltledfervldvnllgtflltraalpllrkrgggr
00474701   1/1  eesvealveavleefgrldilvnnagillplgplldlsledfervldvnllgvflltraalpllrkrggg
00436781   1/1  eesvealvaaaleefgrldilvnnAgillpllllllgplldlsledfervldvnllgtflltraalplmr
00528731   1/1  eesvealveevleefgrldilvnnaGil........sledfervldvnllgtflltraalpllrkrglgg
00500221   1/1  eesvaalvaavleefgrldilvnnagilllgplldltledfdrvldvnllgvflltraalplmrkrgggr
00517021   1/1  eesvealvaavleefgrldilvnnagilllgplldlsledwdrvldvnllgtflltraalplmlkr..gr
00353051   1/1  elesvealveevleefgrldilvnnAGi........lsledwervldvNllgvflltraalplmrkrglg
00416921   1/1  e......veaaleafgrldilvnnagiallgplldlsledwdrvldvnllgvflltraalplmlkrgggr
00499421   1/1  eesvealvaavleefgrldilvnnagilldgplldltledfdrvldvnllgtflltraalplmrkrgggr
00513551   1/1  tdeesvealveeileefgrlgldilvnnAgillplgplldlsledfervldvNllgtflltkaalplmkk
00498451   1/1  eesvealvaaale.fgrldilvnnAgillpllllgplldlsledwdrvldvnllgtflltraalplmrkr
00468011   1/1  eesvealveavleefggrldilvnnAGialpgpll.......ervldvNllgtflltraalpllrkrggg
00489491   1/1  tdeesvealveeileefgrldilvnnaGildldllllgplldlsledwervldvnllgvflltkaalplm
00512601   1/1  DvtdeesvealveevleefgrldilvnnAgillvgplldlsledfervldvnllgtflltraalplmrkr
00482431   1/1  deesvlellealveavleefgrldilvnnaGialpgpllgllllllllldlsleadwervldvnllgvfl
00519551   1/1  avalDvtdeesvealveeileefgrldilvnnagillpgplldlsledwervldvnllgvflltkaalpl
00482861   1/1  deesvealveevleefgrldilvnnAGil..gpledlsledfllervldvNvlgtflltraalplllk..
00486141   1/1  eeavealveaaveafggldvlvnnagillplgplldlsledwdrvldvnllgtflllraalpllvk.g.g
00385591   1/1  eeavaalvaaavellefggldvlvnnagilavgeplldlsledwdrvldvnllgtflllraalplmvk.g
00506551   1/1  tdeesvealveeileefgrldilvnnAGil.vgpledlsleldfervldvNllgtflltkallplmkks.
00511091   1/1  rvlvvaaDvtdeesvealveeileefgrldilvnnAgillpdgpled.sledfervldvNvlgtflltra
00512031   1/1  valDvtdeesvealveeileefgrldilvlnnAGillpgpled.sledwervldvNllgtflltkaalpl
00527441   1/1  vlfvaaDvtdpesvealvaeileef.gldvlvnnAgillvgpledlsledfervldvnvlgtfnllraal
00480351   1/1  g....ralavaadvtdpesvealv.......ggldilvnnagilgallgplldltledwervldvnllgt
00507211   1/1  gDltdpeslaaalagv.....riDvvvhnAgi....plvdlseedpeevldvNvlgtlnlleaa....rk
00490261   1/1  llggrvefvegDltdpesleaaleev.....gvDvvvhnAgissvgpse.ltledpeevldvNvlgtlnl
00498641   1/1  pealeaaleev.....gvdvvihlAgissv....dlseedpeevldvNvlgtlnlleaarka....gvgr
00460341   1/1  qgDltdpeslaaalagv.....riDvvihnAgivsv....dlseedpeevldvNvlgtlnlleaalpagv
00482931   1/1  qgDltdpeslaaalagv.....rldvvvhnAgi....ssvdlseedpeevldvNvlgtlnlleaalpagv
00468971   1/1  ltdpeslaaalagv.....ridvvihnAgiv....lvdlseedpeevldvNvlgtlnlleaalpagvkrg
00495191   1/1  qgDltdpeslaaalagv.....rldvvvhnAgivgv....dlseedpeevldvNvlgtlnlleaalpagv
00493571   1/1  lllggvefvqgDltdpesleaala.......gvdvvvhnAgivgv....dlseedpeevldvNvlgtlnl
00465741   1/1  vqgDltdpeslaaaleev.....gvdvvihnAgi....plvdlseedpeevldvNvlgtlnlleaalpa.
00511831   1/1  Dltdpesleaale.......gvdvvihlAgiasvg.......edpeelidvNvlg....tlnlleaarka
00532871   1/1  tdpdslaaala.......gvdavvhlagivgvgalllllllksllelseedpeevldvnvlg....tlnl
00479651   1/1  inpealeaaaaelgaevvsggealavacdvtdpaavealidaavaafgkldilvnnAgiplvdpeallil
00465291   1/1  eeieaaggk.....avvldvsdeedlkelv.......grlDilvnnagipllkplldltkegwdvidvgv
00514911   1/1  dpeslaaaleev.....gvdvvvhnAgivgv....dlseedpeevldvNvlgtlnlleaalpa....gvg
00433371   1/1  peslaaalagv.....rpdvvvhlAalssv....dlseedpeevldvNvlgtlnlleaarea....gvvg
00491171   1/1  fvqgDltdpeslaaala.......gvdvvvhnAgivsv....dlseedpeevldvNvlgtlnllea....
00464721   1/1  dpeslaaalagv.....rvdvvihlAgi...vsavdlseedpeevldvNvlg....tlnlleaarkagvk
00371281   1/1  dpesleaaleev.ekfggvdvvihlAaissvd......esdpeelldvNvlgtlnlleaarka....gv.
00494281   1/1  vtdeesieelaaeveellgdggldvlinnAGillpsgslgeldleellevfevnvlgpllltqallpllk
00527221   1/1  gvevvvgDltdpeslaealkg.......vdvvinaagttrfg.......edleeflavnvdg....tlnl
00419991   1/1  pealaalleei.....gvdaVihlAaissv....dlseedpeevldvNvlgtlnlleaarka....gvkp
00400431   1/1  pealeaala.......gvdaVvhlAalshv....dlseedpeevlevNvlgtlnlleaarka....gv.r
00519911   1/1  ..gvevvvgDltdpeslaaalk.......gvdvvinaagitrvg.......edleefldvnvdg....tl
00462911   1/1  kgDltdpesleealkgv.....kpdvvihlAaivhv....dlseedpeetidvNvlgtlnlleaarkagv
00367851   1/1  easldaal.......gdaDvvinaapvglhaeiveaaleagkhvvdenpla..aetralleaakeagvgr
00430411   1/1  gDltdpeslaealk.......gvdvVihlag...................dvnvlg....tlnlleaakk
00383241   1/1  llgprvefvegDltdpealaaala....efggvdvVihlAalvhv....dlseedpeevldvNvlgtlnl
00485161   1/1  ellkelgad..........vvidvtdedaveal......agggvdvvvnnaggatlgallel.lapggrv
00421801   1/1  .........qgdvsdleeleeal.......ggaDivvnatgaglpglllelllellkpggvvvdvaypp.
00348721   1/1  rdtedleelvke..........adivvtavgvpdlvkael.......gkpgalVnnaGi..nrlfdeetl
00481861   1/1  peslaealkg.......advvviaagip......rkpgedrldlldvnvlgvknlleaaaka....gvgr
00519251   1/1  dpesleealkg.......vdvvihlAaivgv....dlseedpeetidvNvlgtlnlleaar....kagv.
00430421   1/1  peslaealk.......gvDvVihlagl...............evidvnvlg....tlnlleaakeagnvk
00387841   1/1  dleavedlv....ealggadvvvnnagvp......rkpgeerldllevnvlg....tknlaealkkagpg
00352901   1/1  tenleeavkeaDivivav..gvpglvkaellkpgavvidvdvtdpedvea--------------------
00496861   1/1  lgad..........vvldvtd...veellkallk.lggvdvvihtag....apvtelslsllkqllrvnv
00354771   1/1  alavlldltdtddlaealk.......gadvvvhlagv......prkpgedrddllavnvlg....trall
00521161   1/1  fvegDltdpealeeale.......gvdaVihlAal...ssvgeseedppleflevNvlg....tlnllea
00516961   1/1  tdp..laealag.......vdvvihlagv......vrfsagdpeaflavnvdgt....lnlleaaraagv
00471781   1/1  paslaaala.......gvdaVihlag...........padpldllevnvdgtrnllea....akaagvkr
00484141   1/1  dveele.......ellgkvDivinaaglgepaklldllvellervksgnvlgdlllapevlplleeasek
00484551   1/1  g......avkvdvldldd.......laealggadilinatgagmpplledllpldlalllkvnvvldlay
00405511   1/1  edlveavlelt....ggvDvvvdaagvpatleealrllkpggrlvlvgvaggllpldlarlllkgvnlrg
00502281   1/1  dpddlekalk.......gvDvvihaagtsrvdeslkdal.......gtnvigtssalrllnlleaakeag
00429061   1/1  vealkeltg......grgvdvvlnnvgge.tldaaldllapggrvvlvglisgynlpllllllllkgltl
00374371   1/1  erleelgakfvlltldeelvevvlaltvdvsdeegrlkavetleellgeaDvvivaagippa........
00491981   1/1  sdkealkraladv.....kpdvVihlAavsgp....rvsaadpeavydtnvlgtlnllea....akkagp
00360071   1/1  evvlldrleslekleglaldlsda......atfllgdvsdtadleealk.......gadvvvhlAgvp..
00519961   1/1  dpealeealak......gvdaVihlAalvsv....deseedplefievnvlgtlnlleaar....kag.k
00423401   1/1  qleelgadav.........evdvsdtadleelvaea.......Dvvinaagipgat..............
00530191   1/1  ldllaaala.......gvdvvflaaga..........................gatlalaeaaaaagvkv
00456211   1/1  lpllldvidtddlyealkg.......advvvhtAgvp......rkpgmtrldllevNvki....tknlle
00367461   1/1  gadfvvvykdl.sediieavaellatngggadividtagip.........................gile
00470321   1/1  eelg------------------------------------------------------------------
00482271   1/1  agrl.tattdlaealadadvviiavg............tpldadggadlsyvlaaaralakvlkklgvga
00423421   1/1  ..fleedlg-------------------------------------------------------------
00425341   1/1  lyealkg---------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           IVNVASTAGLIGYGYVSAYCAAKHGVIGLTRSLALELATKGVTVNAVCPGYTETDIVRDAVANIVGKTGR
00515681   1/1  rivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrgllalllllll
00503651   1/1  grivnisSvagllglpglaaYaasKaalegltrslalelapkgirvnavapglvdTpllrgllgllalll
00509671   1/1  .grivnisSlvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrgllallll
00465921   1/1  ledwdrvldvnllgvflltraalplm..rgggsivnissvaglvglpglalayaasKaAlegltrslale
00476811   1/1  ggrivnisSvagllglpglaaYaasKaalegltrslalelaptgirvnavaPGlvdTpllrallaalall
00515111   1/1  plmrkrgllggrivnisSvagllglpglaaYaasKaallgltrslalel..tgirvnavaPglvdTdlla
00499021   1/1  ledwdrvldvnllgvflltkaalplmkk.g.gsIvnissiaglrglpglalayaasKaAlegltrslale
00507761   1/1  rivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrgllalllllll
00421311   1/1  edwdrvldvnllgtflltraalplmrkrsaessggggrivnisSvagllglpglaaYaasKaalegltrs
00383421   1/1  lmrkrglgrivnisSvagllglpgqaaYaasKaalegltrslalelaprgirvnavapglvatplterll
00450761   1/1  plmlkr..grivnisSvaglllglpglaaYaasKaalealtrslalelaprgirvnavapglvdTpmlaa
00376621   1/1  gggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllagllp....
00483611   1/1  ledwdrvldvnllgvflltqaalplmkk.g.gsIvnissiaglvglpglalayaasKaAlegltrslale
00380421   1/1  rivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrglll.......
00517631   1/1  ivnisSvaglllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllrgllpll.....
00471241   1/1  ggrivnisSvagllallllllglpglaaYaasKaallgltrslalelaprgirvnavaPglvdTpllagl
00525291   1/1  ivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllallgllg......
00510061   1/1  g.grivnisSlvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrglla..p
00437031   1/1  g.grivnisSvagllvglpglaaYaasKaalegltrslalelaptgirvnavaPglvdTpllrglllll.
00514401   1/1  lpllrkrgggrivni.SvagllglpgqaaYaasKaalegltrslalelaprgirvnavaPglvdTpllaa
00380681   1/1  rivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrallalllllll
00532861   1/1  krgggrivnisSvagllglpglaaYaasKaalegltrslalelapkgirvnavapglvdTpllrglld..
00502371   1/1  ivnisSvagllgglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllagllld......
00509551   1/1  ldggrivnisSvagllglpllglaaYaasKaalegltrslalelllaprgirvnavapglvdtpllrall
00350181   1/1  rivnisSvagllglpglaaYaasKaalealtrslalelaprgirvnavapglvdTpllaallll.....l
00519651   1/1  ggrivnisSvagllglpgllaaYaasKaalegltrslalelaprgirvnavaPglvdtpllaall.....
00409101   1/1  lggrivnisSvagllglpglaaYaasKaalegltrslalelaptgirvnavapglvdTellralll....
00425051   1/1  rivnisSvaglvglpglaaYaasKaallgltrslalelaprgirvnavaPglvdTpmlaalllgl...ll
00398711   1/1  rivnisSvagllglpglaaYaasKaalealtrslalelaprgirvnavapglvatpllagllllllllll
00464831   1/1  sledwer.ldvNllgvflltkaalplmkkaaklskrgggrivnisSvaglrglpglaaYsasKaaleglt
00515421   1/1  krgggrivnisSvagllglpgqaaYaasKaallgltrslalelaprgirvnavaPGlvdTpmtaalle..
00368061   1/1  krgaesgggggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtplla
00394381   1/1  rivnisSvaglllglpglaaYaasKaalealtrslalelaprgirvnavapglvdTpllagllallllll
00354711   1/1  ag.grivnisSvaglgglpglaaYaasKaalegltrslarelap.girvnavapglvdtpllrglllpll
00529881   1/1  plmre.g.gsivnissv.gllglpglaayaasKaalegltrslalelaprgirVnavaPgpirTpllaal
00499431   1/1  ..rgggrivnisSvagllglpglaaYaasKaalegltrslalelapkgirvnavaPglvdTpllrglll.
00523681   1/1  ivnisSvagllglpglaaYaasKaalegltrslalelapkgirvnavaPglvdtpllrglll.....lll
00520851   1/1  ggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllaal.......
00532661   1/1  .rgggrivnisSiagllglpglaaYaasKaalegltrslalelapkgirvnavapglvdTpllrgl....
00417571   1/1  plmrkrgllggrivnisSvagllglpglaaYaasKaallgltrslalel..tgirvnavaPglvdTdlla
00503831   1/1  llgtflltraalplllkrglggrivnisSvagllglpgqaaYaasKaalegltrslalelaprgirvnav
00416101   1/1  rivnisSvagllglpglaaYaasKaalegltrslalelllaprgirvnavapglvdtpllagllp.....
00512791   1/1  rivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrgllll.....l
00387701   1/1  ivnisSvagllglpglaaYaasKaalegltralalelaprglgirvnavapglvatpllrg......lll
00510931   1/1  mlkrgggrivnisSvagllglpglaaYaasKaalegltrslalelaprglgirvnavaPGlvdTpllrgl
00451531   1/1  krgggrivnisSvagllglpglaaYaasKaalealtrslalelaprgirvnavapglvdTpllaalll..
00369221   1/1  rivnisSvagllglpgqaaYaasKaalealtrslalelaprgirvnavapglvdtpllaal.........
00385451   1/1  ivnisSvagllglpglaaYaasKaalealtrslalelaprgirvnavapglvatpllagl..........
00413661   1/1  ivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpll.............
00424291   1/1  rivnissvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvltpllralll.......
00361941   1/1  rivnissvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvatpllralll.......
00388141   1/1  ivnisSvagllglpgqaaYaasKaalealtrslalelaprgirvnavapglvatpllaall.........
00474701   1/1  rivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdTpllrgllpllll...
00436781   1/1  krgaesglgggrivnisSvagllglpglaaYaasKaalegltrslarelaprgirvnavapglvatplla
00528731   1/1  ggrivnisSvagllglpglaaYaasKaalegltrslalllelaptgirvnavapglvrtpllagllpll.
00500221   1/1  ivnisSvagllglpgqaaYaasKaalealtrslalelaprgirvnavapglvdtpllaal..........
00517021   1/1  ivnisSvagl.glpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllaal..........
00353051   1/1  lggrivnisSvagllglpglaaYaasKaalegltrslalelaptgirvnavaPglvdTpllaglll....
00416921   1/1  ivnissvagllglpglaaYaasKaalegltrslalelaprgirvnavaPglvdTpllaglld........
00499421   1/1  ivnisSvagl.glpgqaaYaasKaalegltrslalelaprgirvnavapglvdtpllaal..........
00513551   1/1  rgalssgellslgggrivnisSiagllglpglgllelplaaYaasKaalegltrslalelapkgirvnav
00498451   1/1  gaasgggggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllagl
00468011   1/1  rivnisSlavygalldlpllelllllllldlledvaglrglplglaaYaasKaalegltrslalelaprg
00489491   1/1  ..rgggrivnissvagllglpglaaYaasKaalegltrslalelapkgirvnavaPglvdTpllrglll.
00512601   1/1  gggrivnisSvagllglpglaaYaasKaalegltrslalelaplgltgirvnavapglvdtpllaallaa
00482431   1/1  ltraalp..llrggglssglggrivnisSvagllglpglaaYaasKaalegltrslalelaprgirvnav
00519551   1/1  mkkrgggrivnisSvagllglpglaaYaasKaalegltrslalelapkgirvnavapglvdtpmlaalll
00482861   1/1  ggrivnvsSvagllglpglddllleelllsdllllllldlllelldlllplledtplgplaaYaasKaal
00486141   1/1  rivnisSvagygplpglaaYaasKaavegltrslalelapllkgirvnavapglvdtpllra........
00385591   1/1  .grivnissvaglgglpglaaYgasKaavegltrslalelapllkgirvnavapgnvdtpmlrg......
00506551   1/1  .grivnisSiagllglpdlglllleelllddlllldllellslllelllealleelllglaaYaasKaal
00511091   1/1  alp.lrkrglgrivnisSiagllglpgqaaYaasKaalealtrslalelallprgirvnavaPGlvdtp.
00512031   1/1  m.krgggrivnisSiagllglpgqaaYaasKaalegltrslalelllapkgirvnavaPGlvdtpllaal
00527441   1/1  pl....gvgrivniSSiagvlgspgqsaYaasKaalealtrslaae....girvnavrpglvatpglvee
00480351   1/1  flltraalplmlarg.grivnissiagllglpglaaYaasKaallgltrsl.------------------
00507211   1/1  agtvgrivnvSS.agvygdpglggpidEddpldplspYgasKaaaeallralarelaptglllelgirvt
00490261   1/1  leaalpa....gvggrivfvSSiavygdpdgpidEddlllvllllllllltplpplsaYgasKaaaelll
00498641   1/1  ivfiSSaavyggseegpidEddpldpplspYgasKaaaellaralarel..ygirvvilrpgnvygpglr
00460341   1/1  krggggglslrivfiSsiavygglpgqsgpitEddpldplspYgasKaaaeallralarel...girvti
00482931   1/1  krggggrivniSSi.gvygdpggpidEddplnplsaYgasKaaaeallralarel...girvtilrpgnv
00468971   1/1  gggglslrivfvSSiavyggpggllevllesllgpldeddplnplspYgasKaaaeallralarel...g
00495191   1/1  ksg.grivniSSiavygdpeglpidEdtplpplspYgasKaaaeallralarel...girvtilrpgnvy
00493571   1/1  leaalpa....gvgrivniSSi.gvyggpggapidEddplnplspYgasKaaaeallralarel...gir
00465741   1/1  ...gvgrivfvSSiavygdpdglpidEgdpglpplspYgasKaaaelllralare..gsgirvtilrpgn
00511831   1/1  gsvkrivfvSSiaavygdplllpglpidEdtwldvdllaalllllelplpplspYgasKaaaealarala
00532871   1/1  leaakaagvkrivlvSslgayggdedtplpplspygasKaaaeallra.......sglrvtilrpglvlg
00479651   1/1  lergilyaPdilanAggvavsv------------------------------------------------
00465291   1/1  ldvnllgvfllakaalpvm...------------------------------------------------
00514911   1/1  rivfvSSiavyggllllppglpidEddplnplspYgasKaaaelllralare.apygirvtilrpgnvyg
00433371   1/1  rivfvSSaavyggppglpidEdtplnplspYgasKaaaellaralare...yglrvvilrpgnvygp...
00491171   1/1  arkagvgrivfvSSi.gvyggpgglpidEdtplpplspYgasKaaaeallralarel...glrvtilrpg
00464721   1/1  rivfvSSiavyggpgglpidEddllllplnplsapYgasKaaaelllralarel...glrvtilrpgnvy
00371281   1/1  rfvytSSaavyggppglpidEdtplnplspYgasKaaaellvralare...yglrvvilrpgnvygpggr
00494281   1/1  kgaakksgeglslsralivnissllGsigdntsgglyaYrasKaALnmltkslaielkdegilvvalhPG
00527221   1/1  aeaakkagvkrfvlvSslgalg..pspspyaasKaaaeallral.......glprvtivrpglvlgplge
00419991   1/1  rfvfiSSaavyggspgqpldesllldvdllpllaitEdtplnplspYaasKaaaealarayare...ygl
00400431   1/1  fvfiSSaavyggspllllllglllldglpidEdtpldplspYgasKaaaellvrayare...yglrvvil
00519911   1/1  nlldaakkagvkrfvlvSslgalg..pspspyaasKaaaeallral.......gldlvtivrpglvlgpl
00462911   1/1  ksg.grfvfiSSsavyggppglpidEddplnplspYgasKaaaelllrayakey...glrvvilrpgnvy
00367851   1/1  ivnvssaagyadgrglpayqaakaalealllglalelgiagirvnailpgfvetpltllvvlvi------
00430411   1/1  agvkrfvfvSsagvygdedtplpplspygasKaaaeallral.......glpvtivrpgnvygpglsg..
00383241   1/1  leaarka....gvkrfvfaSSaavyggnplllllddelpidEddplnplspYgasKaaaeklvrayare.
00485161   1/1  vlvnllggllltrallplllkrgkgrivns................------------------------
00421801   1/1  .llttallplararglgrivdglsmlvlqgapgfely---------------------------------
00348721   1/1  edwllvgdvnllgvlll-----------------------------------------------------
00481861   1/1  ivlvssnpvdgl.....ayaaskaaleg...........sgldvnrvrP---------------------
00519251   1/1  rfvfiSSsavygdpkkgpidEddllllnplnplspYgasKlaaekllrayakey...glrvtilrpgnvy
00430421   1/1  rfvfvSsagvygdedtplnplspygasKaaaekllra.......sglpvtilrpgnvygpglsgliplll
00387841   1/1  rivvvsspagllglpalkvygaskaavi------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00496861   1/1  lgtlnllrallpllvklgvkrivyissv------------------------------------------
00354771   1/1  eaarkagvgrivvvssgnpvdilalv--------------------------------------------
00521161   1/1  arkagvkrfvfaSSsavygdpeglpidEdtlldvdleplnplspYgasKlaaellarayare...ygldv
00516961   1/1  krfvlvSslgaygd..plspyarsKaaaeallral.......glprvtilrpglvygprdgfllallll.
00471781   1/1  lvlvssagaygdepgpplplspyaaskaaaeellra.......sgldytilrpgalfgpg..........
00484141   1/1  girvvtglsilgeqgpaqltlyalskaaviallkvl----------------------------------
00484551   1/1  tplv------------------------------------------------------------------
00405511   1/1  s---------------------------------------------------------------------
00502281   1/1  vkrfvhvstag.................vygllegvpelledallilnpnlygvskll------------
00429061   1/1  lgfl------------------------------------------------------------------
00374371   1/1  ...........taplllteellelmkpg.-----------------------------------------
00491981   1/1  vkrlvfvStag...vygdvsagipidEddpllptspyglsKlaaEqilrslarryldkplnrqhglpvvv
00360071   1/1  ....rkpgmdrldllkvnvkgtknlleaa-----------------------------------------
00519961   1/1  rfvfaSsaavygdpeglpidEddwldveltplnplspYgasKlaaelllrayareygldvvilrpfnvyG
00423401   1/1  .....a----------------------------------------------------------------
00530191   1/1  idlssafrad.d.....................................................vpygl
00456211   1/1  aiakygpkavvvlvvsnpvdiltyialevs----------------------------------------
00367461   1/1  eavdllkpg..gvivdvgl---------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00482271   1/1  ivviestvp-------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           SEEQARAELAARNPQRRLVRPDEVADAVAWLCQPSASAITGQAVPVAGGEVMAG----------------
00515681   1/1  lllllllpeevaeallaliplgrlgtpedvadavlflasdaasyitGqv---------------------
00503651   1/1  lllpeevaeallkliplgrlgtpedvagavlflasdaasyitgqvlvvdgGll-----------------
00509671   1/1  lllll..elleallaliplgrlgtpedvadavlflasdelasyitgqvlvvdg-----------------
00465921   1/1  laprlgirVnavaPgpidTpllaalla.........deelleallariplgr------------------
00476811   1/1  llllllllldllelleallaliplgrlgtpeevaeavlflasdeapllsyit------------------
00515111   1/1  alll......dllleelleallaliplgrlgtpeevaeavlflasde.s---------------------
00499021   1/1  laprlgIrVnavaPGpikTpmlaallgllaellllslllllllllsllelll------------------
00507761   1/1  lllpeevaealldliplgrlgtpedvadavlflasdaasyitgqvlvvdgGll-----------------
00421311   1/1  lalelaprgirvnavaPglvdTpmlral............pelleallaliplgr---------------
00383421   1/1  rlgllllspeevaeallaallsgepvvvvgllllalllllleelleallali------------------
00450761   1/1  lllllllllllilvleelleallaliplgrlgtpeevaeavlflasdeasyi------------------
00376621   1/1  ......eelleallaliplgrlgtpeevaeavlflasdeasyitgqvlvvdgGlt---------------
00483611   1/1  laprlgIrVnavaPgpiltpmlaallga.....lllleelleallariplgr------------------
00380421   1/1  ..deelleallaliplgrlgtpeevaeavlflasdeasyitgqvlvvdgGlt------------------
00517631   1/1  llpeelleallaliplgrlgtpedvadavlflasdaasyitGqvllvdgGlt------------------
00471241   1/1  ...........peelleallaliplgrlgtpeevadavlflasdaasyitgqv-----------------
00525291   1/1  ...peellelllalip..rlgtpeevadavlflasdaasyvtgqvlvvdgGll..---------------
00510061   1/1  eelleallellellldliplgrlgtpedvadavlflasdaaslyitgqvlvvd-----------------
00437031   1/1  .lllllleelleallaliplgrlgtpeevaeavlflasdpeasyitgqvlvvd-----------------
00514401   1/1  lll.......llpeellealldliplgrlgtpedvadavlflasdaasyvtGq-----------------
00380681   1/1  llleevlealldliplgrlgtpedvaeavlflasdaasyitgqvlvvdgGlll-----------------
00532861   1/1  ........eelleallkliplgrlgtpeevadavlflasdeasyitgqvlvvd-----------------
00502371   1/1  ...eelleallaliplgrlgtpeevadavlflasdaasyvtgqvlvvdgGlll-----------------
00509551   1/1  ...........eelleallaliplgrlgtpedvaeavlflasdpasyitg--------------------
00350181   1/1  llleelleallaliplgrlgtpeevaeavlflasdeasyitgqvlvvdgGltllll--------------
00519651   1/1  ...ldleelleallalillplgrlgtpedvadavlflasdaasyvtgqvlvv------------------
00409101   1/1  .llalleelleallaliplgrlgtpeevaeavlflasdeasyitgqvlvvdg------------------
00425051   1/1  llleelleallaliplgrlgtpeevadavlflasdaasyitGqvlvvdgGlt------------------
00398711   1/1  llleellealldgiplgrlgtpedvaeavlflasdeasyitgqvlvvdgGltl-----------------
00464831   1/1  rslalelapkgirvnavaPGllvdTpllr..............eelleallk------------------
00515421   1/1  ...................plgrlgtpeevadavlflasdga.yitgqvlvv------------------
00368061   1/1  gllg..........eellelllaliplgrlgtpeevaeavlflasd..syvtgq----------------
00394381   1/1  lllllpeelleallaliplgrlgtpeevaeavlflasdaasyitgqvlvvd-------------------
00354711   1/1  llalll.gellevlgdgiplgrlgtpedvadavlflasdpeasyitgqvlnv------------------
00529881   1/1  laalaallllllleelleallaliplgrllgtpeevanavlflasdaasyitGqv---------------
00499431   1/1  ........leelleallkliplgrlgtpeevadavlflasdaasyitgqvlvvd----------------
00523681   1/1  lpeelleallkliplgrlgtpeevadavlflasdaasyitgqvlvvdggll.all---------------
00520851   1/1  ....leelleallaliplgrlgtpeevadavlflasdaasyvtgqvlvvdgGl-----------------
00532661   1/1  .....llpeelleallkliplgrlgtpedvadavlflasdaasyitgqvlvvd-----------------
00417571   1/1  all......lglldpelleallaliplgrlgtpeevadavlflasdp.----------------------
00503831   1/1  apglvdTpllrgllllp........eelleallaliplgrlgtpedvadavlf-----------------
00416101   1/1  .....eellelllaliplgrlgtpeevaeavlflasddasyitgqvlvvdgGl-----------------
00512791   1/1  llleelleallaliplgrlgtpeevadavlflasd.asyvtgqvlvvdgGll------------------
00387701   1/1  lalleellallldgiplgrlgtpedvaeavlflasddasyitgqvlvvdgGltll---------------
00510931   1/1  lae...................iplgrlgtpeevadavlflasdgasyvtgq------------------
00451531   1/1  ....lllleelleallaliplgrlgtpeevaeavlflasdeasyitgqvlvvdgGl--------------
00369221   1/1  ..leelleallaliplgrlgtpeevaeavlflalsdeasyitgqvlvvdgGl------------------
00385451   1/1  .lpellelllaliplgrlgtpeevaeavlflasdeasyitgqvlvvdgGlll------------------
00413661   1/1  ...eallellaliplgrlgtpeevaeavlflasdeasyitgqvlvvdgGlll------------------
00424291   1/1  ..leellaallaliplgrlgtpedvadavlflasdpasyitgqvlvvdgGltl-----------------
00361941   1/1  ..leelleallaliplgrlgtpedvaeavlflasdpasyitgqvlvvdgGlll-----------------
00388141   1/1  ..eellelllaliplgrlgtpeevaeavlflasddasyitgqvlvvdgGl--------------------
00474701   1/1  llpeevleallaliplgrlgtpedvadavlflasdaasyitgqvlvvdgG--------------------
00436781   1/1  gllg..........eellealldliplgrlgtpedvaeavlflasd------------------------
00528731   1/1  ..llllleellealldliplgrlgtpedvaeavlflasd..syvtgqvlvvlldg---------------
00500221   1/1  .leelleallaliplgrlgtpeevadavlflasdeasyitgqvlvvdgGlll------------------
00517021   1/1  .leelleallaliplgrlgtpeevaeavlflasdeasyitgqvlvvdgGllll-----------------
00353051   1/1  .....dpelleallaliplgrlgtpeevaeavlflasd...yvtgqvlvvdg------------------
00416921   1/1  ..eellelllaliplgrlgtpeevaeavlflasdaasyitgqvlvvdgGllllgl---------------
00499421   1/1  .leelleallaliplgrlgtpeevadavlflasdeasyitgqvlvvdgGlllll----------------
00513551   1/1  apglvdTpllrgl..........................Alltpeevaeallf-----------------
00498451   1/1  lp..........eellallldgiplgrlgtpedvadavlflasd..syvtgq------------------
00468011   1/1  irvnavaPglvdTpllrgllal.........eelleallalilplgrlgtped-----------------
00489491   1/1  ........leelleallkliplgrlgtpeevadavlflasdaasyitgqvlvv-----------------
00512601   1/1  .....................lgrlgtpedvaeavlflasdeasyitgq...------------------
00482431   1/1  aPglvdTpll.............lpeelleallaliplgrllgtpeevadavlfl---------------
00519551   1/1  e....................plgrlgtpeevaeavlflasdeasyitgqvlvvd.--------------
00482861   1/1  egltrslarelllllapkgirvnavaPglvdtpllrglla.............-----------------
00486141   1/1  ...........lgdgtplgrlgtpedvaeavlflasdaaslyitgqvlnvdg------------------
00385591   1/1  .............lldgtplrrlgtpedvaeavlflasdeasyitgqvlnvd------------------
00506551   1/1  egltrslalelllllapkgirvnavaPGlvdtpllrgll...............----------------
00511091   1/1  .................................................---------------------
00512031   1/1  llalalllllllalallllaallaaaaaalllllaall...........---------------------
00527441   1/1  l..............laellariplgrl.tpedvaravlfllsda..yvtgqvlv---------------
00480351   1/1  ----------------------------------------------------------------------
00507211   1/1  ivrpgnvygpglgfpgnllplllraalaglplpv..gdgdqvrdfihvddv-------------------
00490261   1/1  ralarel...girvtilrpgnvygpglrplgligellllldpsgvvggllpr------------------
00498641   1/1  pllgedplgalggllplllraalgkgepltvlgldyptgdgdqvrdfihvdD------------------
00460341   1/1  lrpgnvygpg.........ggpgnllplllraalaglplpvlgdgdqvrdfi------------------
00482931   1/1  ygpggrpglvtsllplflrlalaglpltlv.lgdgdqvrdfihvddvaravl------------------
00468971   1/1  irvtilrpgnvygpggrp.........gnllplllraalagkplpvlgdgdq------------------
00495191   1/1  gpggrpllvtsllplflrlalaggplplv.lgdgdqvrdfihvddvaravll------------------
00493571   1/1  vtivrpgnvygpglrplg.....vtgsllplllraalaggplpvlgdgeqvr------------------
00465741   1/1  vygpglspllgelllgvpdsllplflraalgglgplpvlgslydtlDgdqvr------------------
00511831   1/1  relap.glrvvilrpgnvygpglrptlvtsliplfiaailaglpl...r---------------------
00532871   1/1  pllsg...........lrlggllllgdgdalrsfisvedvadavvlaledpa------------------
00479651   1/1  ----------------------------------------------------------------------
00465291   1/1  ----------------------------------------------------------------------
00514911   1/1  pllsgllgelllgvpgsliplllraalgggeplpvfgslyltlDgdqvrdfi------------------
00433371   1/1  ..ggrpdgvtsnliplllrlalggepltvlgdgdqvrdfvhvdDvaeav---------------------
00491171   1/1  nvygpgggp.........gnllplllraalaglpltvlgdgdqvrdfihvdd------------------
00464721   1/1  gpggrpllglsgvlprlirlallaalaglpvltvlgdgdqvrdfihvddv--------------------
00371281   1/1  pdgltssviplllrlalagepltlvlg..dgdqlrdfihvdDvadaillale------------------
00494281   1/1  wvkTdmggp...nalltveesvegllkvid----------------------------------------
00527221   1/1  plpgelllaggl......lllgdgdakrspisvddvaralvaaledpaa...------------------
00419991   1/1  rvvilrpgnvyGpggrpglpsgvlpllirqilraalglggpltvfgdgd---------------------
00400431   1/1  rpgnvyGpggrpe.........sliplllraalkggpltvfgdgdqvrd---------------------
00519911   1/1  lspllgeall......lpgllllgdgdakrrpisvedvaravvaaledpaa.------------------
00462911   1/1  Gpgggpdgvtskviplliraalkgkp..lpilgdgdqtrdfihvdDvaeail------------------
00367851   1/1  ----------------------------------------------------------------------
00430411   1/1  ..........iplllrlalkggpllilgdgdakrdfvhveDvaravvla---------------------
00383241   1/1  ..yglpvvilrpgnvyGpggspllgeshvlptlllplilqvalggatas---------------------
00485161   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00348721   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00519251   1/1  Gpgqrpng..gsviplfirlilkg.kpltifgdgdqtrdfihvdDvaeaill------------------
00430421   1/1  klalkggpllilg..dgdqkrdfihvdDvaravvlaledp..eatgeiynlg------------------
00387841   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00521161   1/1  vilrpfnvyGpgdrpngvtgsviplliraalgkgepltvfgdgdqvrdfihv------------------
00516961   1/1  ........llllgdgdqrrspihvddvaralvaalld..paaagkvynlggp------------------
00471781   1/1  .....rtgvllllgdgdglrslisvddvAaalvlaledp..eaagkvyel--------------------
00484141   1/1  ----------------------------------------------------------------------
00484551   1/1  ----------------------------------------------------------------------
00405511   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00429061   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00491981   1/1  lrpgnvyGpgdqllsrliprlvkaalegk...plpiagdgarrdlvhvdDva------------------
00360071   1/1  ----------------------------------------------------------------------
00519961   1/1  pglspllgeshvlggliplfiraalggkpltvfg...........dgdqvrd------------------
00423401   1/1  ----------------------------------------------------------------------
00530191   1/1  pkvnaealllasglni.iarpgcyttplvlalaplleag-------------------------------
00456211   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------