[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF09298.1


[Show Plain Result]

## Summary of Sequence Search
   1::597
   1::206  4.2e-63 41.8% 0037407 00374071 1/1   p containing nucleoside triphosphate hy 
   2::230    8e-55 36.2% 0041170 00411701 1/1   p containing nucleoside triphosphate hy 
   2::192  1.9e-52 44.6% 0043133 00431331 1/1   p containing nucleoside triphosphate hy 
   2::193  2.6e-51 39.6% 0036239 00362391 1/1   p containing nucleoside triphosphate hy 
   2::200  1.3e-50 42.3% 0037248 00372481 1/1   p containing nucleoside triphosphate hy 
   1::198  2.8e-50 41.1% 0051648 00516481 1/1   p containing nucleoside triphosphate hy 
   2::195  5.5e-50 42.3% 0039672 00396721 1/1   p containing nucleoside triphosphate hy 
   1::193  2.4e-48 40.4% 0036958 00369581 1/1   p containing nucleoside triphosphate hy 
   1::191  1.1e-47 39.7% 0046936 00469361 1/1   p containing nucleoside triphosphate hy 
   2::186  2.7e-46 41.9% 0050423 00504231 1/1   p containing nucleoside triphosphate hy 
   2::184  8.9e-46 43.9% 0049292 00492921 1/1   p containing nucleoside triphosphate hy 
   3::182  8.9e-45 44.4% 0050449 00504491 1/1   p containing nucleoside triphosphate hy 
   2::182  5.3e-44 43.2% 0052054 00520541 1/1   p containing nucleoside triphosphate hy 
   1::184  5.2e-43 39.7% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
   1::216    5e-39 26.2% 0035786 00357861 1/1   p containing nucleoside triphosphate hy 
   1::182  3.9e-37 39.4% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
   1::189  4.8e-34 34.1% 0046551 00465511 1/1   p containing nucleoside triphosphate hy 
 165::288  3.1e-33 44.2% 0052053 00520531 1/1   lation proteins                         
   2::184  1.2e-32 33.8% 0049485 00494851 1/1   p containing nucleoside triphosphate hy 
   5::188  4.7e-32 33.3% 0048180 00481801 1/1   p containing nucleoside triphosphate hy 
   2::180  4.9e-32 36.2% 0048426 00484261 1/1   p containing nucleoside triphosphate hy 
   1::181  1.6e-31 25.9% 0051461 00514611 1/1   p containing nucleoside triphosphate hy 
   1::188  2.3e-31 31.0% 0044233 00442331 1/1   p containing nucleoside triphosphate hy 
   3::186  2.6e-31 33.3% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
   2::185  6.7e-31 32.3% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
   5::182    1e-30 39.7% 0052691 00526911 1/1   p containing nucleoside triphosphate hy 
   2::189  1.3e-30 33.7% 0050482 00504821 1/1   p containing nucleoside triphosphate hy 
   1::188  1.7e-30 25.4% 0052002 00520021 1/1   p containing nucleoside triphosphate hy 
   1::181  2.2e-30 36.7% 0051510 00515101 1/1   p containing nucleoside triphosphate hy 
   1::181  2.3e-30 34.2% 0051582 00515821 1/1   p containing nucleoside triphosphate hy 
   2::183  4.9e-30 31.7% 0036153 00361531 1/1   p containing nucleoside triphosphate hy 
   2::183  2.1e-29 29.9% 0037045 00370451 1/1   p containing nucleoside triphosphate hy 
   1::184  2.8e-29 25.5% 0052735 00527351 1/1   p containing nucleoside triphosphate hy 
   1::183  4.6e-29 25.0% 0051460 00514601 1/1   p containing nucleoside triphosphate hy 
   2::179    6e-29 31.8% 0048819 00488191 1/1   p containing nucleoside triphosphate hy 
   2::186    6e-29 27.9% 0052724 00527241 1/1   p containing nucleoside triphosphate hy 
   4::193  1.2e-28 32.9% 0049868 00498681 1/1   p containing nucleoside triphosphate hy 
   4::187  1.3e-28 30.2% 0052914 00529141 1/1   p containing nucleoside triphosphate hy 
   6::183  1.4e-28 34.0% 0052346 00523461 1/1   p containing nucleoside triphosphate hy 
   1::186  2.2e-28 36.1% 0052859 00528591 1/1   p containing nucleoside triphosphate hy 
   1::185  3.1e-28 33.8% 0051927 00519271 1/1   p containing nucleoside triphosphate hy 
   1::189  3.4e-28 24.3% 0050792 00507921 1/1   p containing nucleoside triphosphate hy 
   1::178    4e-28 34.4% 0051448 00514481 1/1   p containing nucleoside triphosphate hy 
   1::185  1.1e-27 27.9% 0052502 00525021 1/1   p containing nucleoside triphosphate hy 
   2::186  1.3e-27 27.7% 0051704 00517041 1/1   p containing nucleoside triphosphate hy 
   1::189  1.5e-27 26.3% 0052615 00526151 1/1   p containing nucleoside triphosphate hy 
   2::183  1.6e-27 29.6% 0039999 00399991 1/1   p containing nucleoside triphosphate hy 
   1::182  1.8e-27 30.2% 0051104 00511041 1/1   p containing nucleoside triphosphate hy 
   2::181  1.8e-27 23.6% 0052680 00526801 1/1   p containing nucleoside triphosphate hy 
 398::494  1.9e-27 38.5% 0050451 00504511 1/1   C-terminal domain-like                  
   2::182  2.5e-27 31.0% 0051793 00517931 1/1   p containing nucleoside triphosphate hy 
   1::181  2.7e-27 33.1% 0037412 00374121 1/1   p containing nucleoside triphosphate hy 
   1::190    5e-27 26.3% 0052625 00526251 1/1   p containing nucleoside triphosphate hy 
   2::182  6.5e-27 26.5% 0035814 00358141 1/1   p containing nucleoside triphosphate hy 
   2::196    2e-26 28.0% 0053196 00531961 1/1   p containing nucleoside triphosphate hy 
   2::184  8.7e-26 27.3% 0044416 00444161 1/1   p containing nucleoside triphosphate hy 
   1::182    1e-25 24.5% 0051462 00514621 1/1   p containing nucleoside triphosphate hy 
   3::182  1.5e-25 25.5% 0051471 00514711 1/1   p containing nucleoside triphosphate hy 
   2::186  2.1e-25 27.0% 0052832 00528321 1/1   p containing nucleoside triphosphate hy 
   2::183  2.4e-25 23.3% 0051459 00514591 1/1   p containing nucleoside triphosphate hy 
   4::183    4e-25 28.1% 0051450 00514501 1/1   p containing nucleoside triphosphate hy 
   5::178  4.2e-25 33.6% 0051156 00511561 1/1   p containing nucleoside triphosphate hy 
   2::192  4.3e-25 27.1% 0052879 00528791 1/1   p containing nucleoside triphosphate hy 
   1::185  4.5e-25 28.3% 0048154 00481541 1/1   p containing nucleoside triphosphate hy 
   1::186  6.3e-25 25.7% 0052764 00527641 1/1   p containing nucleoside triphosphate hy 
   1::185  1.1e-24 27.9% 0046392 00463921 1/1   p containing nucleoside triphosphate hy 
   1::183  1.4e-24 26.2% 0045559 00455591 1/1   p containing nucleoside triphosphate hy 
   1::186  1.4e-24 28.0% 0051832 00518321 1/1   p containing nucleoside triphosphate hy 
   1::182  1.8e-24 28.8% 0052841 00528411 1/1   p containing nucleoside triphosphate hy 
 182::289  2.5e-24 42.2% 0050448 00504481 1/1   lation proteins                         
   2::180  2.8e-24 25.0% 0038731 00387311 1/1   p containing nucleoside triphosphate hy 
   3::181  6.7e-24 28.7% 0051562 00515621 1/1   p containing nucleoside triphosphate hy 
 401::516  9.9e-24 25.2% 0048254 00482541 1/1   C-terminal domain-like                  
   4::180  1.6e-23 25.3% 0036279 00362791 1/1   p containing nucleoside triphosphate hy 
   3::177  1.8e-23 27.6% 0051458 00514581 1/1   p containing nucleoside triphosphate hy 
   2::183  3.4e-23 27.2% 0044990 00449901 1/1   p containing nucleoside triphosphate hy 
   1::182  4.4e-23 28.4% 0051472 00514721 1/1   p containing nucleoside triphosphate hy 
   1::178  8.2e-23 35.2% 0042471 00424711 1/1   p containing nucleoside triphosphate hy 
   1::180  1.3e-22 24.2% 0041234 00412341 1/1   p containing nucleoside triphosphate hy 
   3::183  1.5e-22 30.4% 0040239 00402391 1/1   p containing nucleoside triphosphate hy 
 398::495  3.5e-22 37.5% 0052057 00520571 1/1   C-terminal domain-like                  
   1::184    4e-22 27.9% 0049269 00492691 1/1   p containing nucleoside triphosphate hy 
   5::185  4.6e-22 27.5% 0051831 00518311 1/1   p containing nucleoside triphosphate hy 
   5::181  6.5e-22 29.1% 0052098 00520981 1/1   p containing nucleoside triphosphate hy 
   1::185  1.8e-21 25.3% 0052528 00525281 1/1   p containing nucleoside triphosphate hy 
   5::187  1.9e-21 27.6% 0052785 00527851 1/1   p containing nucleoside triphosphate hy 
   3::184  2.1e-21 27.2% 0037884 00378841 1/1   p containing nucleoside triphosphate hy 
   3::186  2.6e-21 27.4% 0044740 00447401 1/1   p containing nucleoside triphosphate hy 
 186::280  3.4e-21 38.0% 0039670 00396701 1/1   lation proteins                         
   5::180  4.2e-21 29.4% 0040747 00407471 1/1   p containing nucleoside triphosphate hy 
 183::282  1.3e-20 32.0% 0037246 00372461 1/1   lation proteins                         
   3::185  9.5e-20 23.6% 0040315 00403151 1/1   p containing nucleoside triphosphate hy 
   2::184  1.1e-19 26.4% 0035281 00352811 1/1   p containing nucleoside triphosphate hy 
   1::184  1.7e-19 31.6% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
 290::370  1.9e-19 35.1% 0050452 00504521 1/1   C-terminal domain-like                  
   1::181  3.4e-19 30.4% 0036699 00366991 1/1   p containing nucleoside triphosphate hy 
 188::284  3.5e-19 29.8% 0037405 00374051 1/1   lation proteins                         
   1::184  7.3e-19 26.1% 0044482 00444821 1/1   p containing nucleoside triphosphate hy 
   1::184  1.1e-18 31.0% 0038732 00387321 1/1   p containing nucleoside triphosphate hy 
 184::282  1.6e-18 26.5% 0036237 00362371 1/1   lation proteins                         
 290::371  1.6e-18 34.2% 0046824 00468241 1/1   C-terminal domain-like                  
   2::181  1.8e-18 30.1% 0047023 00470231 1/1   p containing nucleoside triphosphate hy 
 186::278  1.8e-18 27.2% 0046538 00465381 1/1   lation proteins                         
   2::185  2.4e-18 30.6% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
   5::216  2.9e-18 25.8% 0050741 00507411 1/1   p containing nucleoside triphosphate hy 
 288::369  5.4e-18 37.2% 0048253 00482531 1/1   C-terminal domain-like                  
   3::187  1.1e-17 23.6% 0052501 00525011 1/1   p containing nucleoside triphosphate hy 
   1::180  2.3e-17 29.5% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
 290::367  4.2e-17 32.0% 0052056 00520561 1/1   C-terminal domain-like                  
   5::183  5.2e-17 26.5% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
   5::185  8.6e-17 26.2% 0048113 00481131 1/1   p containing nucleoside triphosphate hy 
   2::178  1.7e-16 28.3% 0051784 00517841 1/1   p containing nucleoside triphosphate hy 
   3::181  1.7e-16 24.1% 0041400 00414001 1/1   p containing nucleoside triphosphate hy 
   4::181  1.8e-16 25.0% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
   5::143  2.2e-16 29.2% 0049759 00497591 1/1   p containing nucleoside triphosphate hy 
 182::281    8e-16 28.7% 0049110 00491101 1/1   lation proteins                         
   2::184  1.2e-14 26.9% 0050775 00507751 1/1   p containing nucleoside triphosphate hy 
  14::184  1.2e-14 29.3% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
   2::186  2.8e-14 21.7% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
 185::279  3.2e-14 24.7% 0050420 00504201 1/1   lation proteins                         
   6::178  1.2e-13 22.6% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
 185::281  2.4e-13 28.6% 0051646 00516461 1/1   lation proteins                         
  16::181  2.7e-13 26.6% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
   3::186  3.8e-13 22.0% 0051952 00519521 1/1   p containing nucleoside triphosphate hy 
   2::186  1.1e-12 22.8% 0049404 00494041 1/1   p containing nucleoside triphosphate hy 
 147::286  1.7e-12 27.8% 0048252 00482521 1/1   lation proteins                         
  16::180  2.9e-12 27.3% 0049582 00495821 1/1   p containing nucleoside triphosphate hy 
  16::182  4.8e-12 24.8% 0047547 00475471 1/1   p containing nucleoside triphosphate hy 
   2::190  9.2e-12 20.9% 0052005 00520051 1/1   p containing nucleoside triphosphate hy 
 183::283  2.4e-11 25.0% 0040119 00401191 1/1   lation proteins                         
   1::177  5.2e-10 29.3% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
  16::181  4.4e-09 29.3% 0046711 00467111 1/1   p containing nucleoside triphosphate hy 
 182::279  1.1e-08 27.8% 0045034 00450341 1/1   lation proteins                         
  16::183  2.9e-08 28.7% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
   1::187    1e-07 27.0% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
  16::177  1.9e-07 32.3% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
 187::323  3.9e-06 25.4% 0037975 00379751 1/1   lation proteins                         
  10::155  8.7e-06 24.8% 0038794 00387941 1/1   p containing nucleoside triphosphate hy 
  75::180  0.00071 24.0% 0036095 00360951 1/1   p containing nucleoside triphosphate hy 
   1::597


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDHIRNFSIIAHIDHGKSTLADRIIQRCGGLSDREMEAQVLDSMDIEKERGITIKAQTAALSYKARDGQV
00374071   1/1  lkkkrirniaivGhvdaGKtTLlnaLlgtlgaiseaglvkllkeagelgkgslllaavldsleeerergi
00411701   1/1  -kfslelllalmldlerirniaiiGhvdaGKTTLterLlyytgiiseagevdltvtDtledEreRgiTik
00431331   1/1  -ledlldlllllllllllslllkrilniaiiGhvdaGKsTLlnallgltgaiseagavklgkealelgkg
00362391   1/1  -krirnvaivGhvdvGKtTLlnaLlgllgaivgdvallalvldslkeerergiTidigavtletdg....
00372481   1/1  -dlslllkrirnvaivGhvdaGKsTLlnaLlgalgaiveagevklalvldsleeerergitidsgavsle
00516481   1/1  lkllelkrirniaiiGhvdaGKsTLlnrLlgetgaidedlllklevlakklgevddglllaivldklele
00396721   1/1  -krllnvaivGhvdvGKSTLlnrLlgdsgaiveagtvkdgkvlallgkgsfllllvldsldeerergiti
00369581   1/1  kkrirnvaiiGhvdvGKsTLlnaLlgalgaivsdvadlalvldllklerergitidiglvsleldg....
00469361   1/1  MkkripkiaivGhpnvGKsTLlnrllgakfaigyigtvgndpgttrldsleeerergitidsglvkfeln
00504231   1/1  -mkkklrnvaivGhvnvGKsTLlnrLlgelglidk........dvaiverergiTidialvilelkg...
00492921   1/1  -ekkirnvaivGhvnaGKtTLlnrLlgek............ldilseerergitidsaattleldgrdll
00504491   1/1  --rirniaiighvdaGKTTlteaLllytgaiskagevkdga...avlDwmelEkergitikssavslew.
00520541   1/1  -ldlerirniaiiahvdaGKTtltealllytgaiskagevddgaavlDwmelEreRgitikssavsley.
00517691   1/1  lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdggtlllllgllsfllalvldslplerer
00357861   1/1  kkdklfkillvGdsgvGKTtLlnrllg...............deflveyiptigidfytktvei...dgk
00401211   1/1  elkrglnvgivGhvgaGKSTLlnaLlgll............ldtlkgelergitikigaasllldklaiv
00465511   1/1  ekkrllkvalvGlpnvGKStllnallgakfai..............vedepgitidinlg.vel...dgk
00520531   1/1  ----------------------------------------------------------------------
00494851   1/1  -ldllglelllslldrllllkkkllkvalvGlpgvGKStLlnall.............gakflakvsptp
00481801   1/1  ----akialvGlpnvGKStllnallga..............dfaivedtpgttidinlgvveldg.....
00484261   1/1  -kkllkialvGhpnvGKStLlnrl................tgekv....pgttgaidii.gtveldg...
00514611   1/1  lkkllkvvlvGdpgvGKttLlnrllg...............gefiveyiptigvdfltktvev...dgkk
00442331   1/1  kkkllkivlvGdpgvGKstLlnrllg...............de.fvedyagttgdnivktvel...dgkk
00471271   1/1  --prailelesliksllekllellkrlslklkkglkvalvGrpgvGKStLlnallg..............
00409841   1/1  -lslelkkglkvalvGrpgvGKSTLlnaLlga..............dlaivsdipgttrdpilgvvlldg
00526911   1/1  ----rkvalvGlpnvGKStLlnrllgakvs..................epgtTiginfgtvelk..dgkl
00504821   1/1  -eklrllkvalvGlpnvGKStllnallgakfai..............vedepgitidinlgtveldgk..
00520021   1/1  lkkkllkivvvGdsgvGKttLlnrllg...............gkfieeyiptigidfytktvev...dgk
00515101   1/1  pleelllslllkkllkvalvGlpnvGKstllnrll................ggkfvereptitidigtve
00515821   1/1  glllllllslelkkllkvalvGlpnvGKstLlnrll..................gakfvsrgpTiginlg
00361531   1/1  -kkllkivlvGdpgvGKstllnrl................lgnefvedypgttgdlivktvel...dgkk
00370451   1/1  -kkllkillvGdpgvGKstLlnrllg...............defiveyiptitvdfltktvel...dgkl
00527351   1/1  kdkllkivlvGdsgvGKttllnrllg...............gefiveyiptigvdfltktiel...dgkk
00514601   1/1  lkkkllkivlvGdsgvGKTsLlnrllg...............gefiveyiptigvdfytktvev...dgk
00488191   1/1  -fllsllrrlslllkrllkvalvGlpgvGKStLlnall.............gakflakvsptpgttrdik
00527241   1/1  -mselkllkvvlvGrpnvGKstLlnrllg................gkfvedypgttgdfllktvel...d
00498681   1/1  ---llkvalvGlpnvGKStllnallg...............dkfivsnipgitidpnvgtvel...dgk.
00529141   1/1  ---llkvalvGrpnvGKstLl.rl................lggkfvedypg.tigdfivgtvel...dgk
00523461   1/1  -----akvalvGlpnvGKStLlnall...............gdkaivsdipgitrdiqtgtle.......
00528591   1/1  sallllllelkkllkvalvGlpnvGKstLlnrll..................ggkfseygtTiginfgtv
00519271   1/1  sllsslllkkllkvalvGlpnvGKstllnrll..................ggkfseygtTiginfgtvel
00507921   1/1  sskkkkllkivlvGdsgvGKtsLlnrllg...............defiveyiptigvdfltktiev...d
00514481   1/1  alllslllkkllkvalvGlpnvGKstllnrllg..................gkfseygtTidinfgtvel
00525021   1/1  eldkllkvvlvGdpnvGKssLlnrll................gdvfvsdypgttgdflvktvel...dgk
00517041   1/1  -kkllkvvlvGdpnvGKstLlnrl...............lgdkfivsyiptitrdfllktvel...dgkl
00526151   1/1  elkkllkvvllGdsgvGKTtllnrllg...............gkfieeyiptigvdfgtvtleledlylk
00399991   1/1  -kkelkvvlvGdpgvGKstLlnrll................ggefvedypgttgdflvktvel...dgkt
00511041   1/1  ekkllkvvlvGrpnvGKstLlnrl................lggkfvedypgttgdfllktvel...dgkk
00526801   1/1  -kkelkvvllGdsgvGKtsLlnrllg...............gefiveyiptigvdfytktvev...dgkk
00504511   1/1  ----------------------------------------------------------------------
00517931   1/1  -kkllkvalvGlpnvGKstllnrllg.................dkvsdepgtTidinfgtveldg.....
00374121   1/1  gellrlslllkkllkvvlvGlpnvGKstLlnrll.................ggdf.depgpTiginfgtv
00526251   1/1  kdkllkvvlvGdpgvGKstLlnrllg...............gefiveyiptitvdflvktvel...dgkt
00358141   1/1  -kkelkvllvGdsgvGKstLlnrll................ggefvedyapttgdditktvel...dgkk
00531961   1/1  -kkllkvvlvGdpnvGKstLlnrllggkf.vsdy...............pgttgdfivktvel...dgkt
00444161   1/1  -ekkdklfkillvGdsgvGKttLlnrllg...............defiveyiptigvdfytktvev...d
00514621   1/1  lkkllkvvlvGdsgvGKtsLlnrllg...............gefiveyiptigvdfytktvev...dgkk
00514711   1/1  --kelkvvlvGdpgvGKtsllnrllg...............defiveyiptigvdfltktvev...dgkt
00528321   1/1  -dkllkvvlvGdpnvGKssLlnrll...............ggkfivsyiptiltldfivktvel...dgk
00514591   1/1  -kkllkvvllGdsgvGKTsLlnrllg...............gefiveyiptigvdfytktiev...dgkk
00514501   1/1  ---lk.vvlvGrpnvGKstLlnrllg...............gkfivsyiptitldfllktvel...dgke
00511561   1/1  ----lkvalvGlpnvGKStllnall..............gadfaiventpgttidiklvvvelkg.....
00528791   1/1  -kkkllkvvlvGdpnvGKstLlnrllg................gkfvsdypgttrdfnlktvel...dgk
00481541   1/1  glkkllkvvlvGdpnvGKstLlnrll................ggvfvsdypgttgdfivktvel...dgk
00527641   1/1  lkkkkllkivllGdsgvGKTsllnrllg...............gefveeyiptigvdfytktiev...dg
00463921   1/1  l.kllkvvlvGdpnvGKssLlnrll................ggkfvsdypgttrdfivktvel...dgkl
00455591   1/1  kkdkllkilvvGdsgvGKttllnrllg...............gefiveyiptigidfytktvev...dgk
00518321   1/1  msslelkkllkvvlvGdpnvGKstLlnrll................ggkfvsdypgttvdfnvktvel..
00528411   1/1  sllkkllkvvlvGrpnvGKstLlnrll...............ggkfaivsyiptitldfllgtvel...d
00504481   1/1  ----------------------------------------------------------------------
00387311   1/1  -kkllkillvGdsgvGKtsLlnrllg...............gefiveyiptigvdfltktvev...dgkk
00515621   1/1  --kelkvlllGlsgvGKTtllnrllg.................gefleeygpTigvnfvtvdlkd.....
00482541   1/1  ----------------------------------------------------------------------
00362791   1/1  ---elkilvvGdsgvGKttLlnrllg...............gefiveyiptigvdfytktvev...dgkk
00514581   1/1  --kelkvvlvGrpnvGKssLlnrllg...............gkfivsyiptitrdfilktvel...dgkk
00449901   1/1  -kkkkkllkillvGdsgvGKStLlnrllg...............gkfivsyiptitvdiltktvel...d
00514721   1/1  lskkelkvvlvGdpnvGKssLlnrl................lggkfvsdypgttgdnilktvel...dgk
00424711   1/1  hskkaldelelvldnadvilevvdardpllsldvrlaellegkprllvlnKaDlldaealalllealslg
00412341   1/1  lkkkkllkillvGdsgvGKtsLlnrllg...............gefiveyiptigvdfltktvev...dg
00402391   1/1  --kelkvlllGlpnvGKstllnrll.................ggdf.depgtTigvnvgtveldg.....
00520571   1/1  ----------------------------------------------------------------------
00492691   1/1  GlkkllkvvlvGdpnvGKStLlnrl................lggkfvsdypgttrdfnvktvel...dgk
00518311   1/1  ----gelkvvlvGdpnvGKssLlnrll................ggkfvedypgttgdtilktvel...dg
00520981   1/1  ----glkvvlvGdpnvGKstLlnrllg...gvfvsdypgttgdfivktve................ldgk
00525281   1/1  kkdkllkvvlvGdsgvGKTsLlnrllg...............gefiveyiptigvdfytktvev...dgk
00527851   1/1  ----lelkvvlvGdpnvGKstLlnrllg...gkfvsdypgttgdnilktvel................dg
00378841   1/1  --kelkillvGdsgvGKstLlnrllg...............defiveyiptigvdvytktvei...dgkk
00447401   1/1  --kelkivlvGdsgvGKttLlnrllg...............nkfivsyiptitvdiltkevei...dgkr
00396701   1/1  ----------------------------------------------------------------------
00407471   1/1  ----lkvllvGlpnvGKsTLlnrll.................gdkv.dkpgtTiginlgtveldg.....
00372461   1/1  ----------------------------------------------------------------------
00403151   1/1  --kglkivlvGdsgvGKTtLlnrllg...............defpvsyiptigvdfyvktvei...dgkk
00352811   1/1  -lekkelkilllGlgnvGKsTllnrllgge.................f..ergpTiginvetfeidg...
00410321   1/1  lkkglkilllGlngaGKTTllnrll.................ggefp.eygptiginvgtveldg.....
00504521   1/1  ----------------------------------------------------------------------
00366991   1/1  lkkllkillvGlpgvGKTtllnrll..................ggefeeyvptiginfvtveikg.....
00374051   1/1  ----------------------------------------------------------------------
00444821   1/1  elkkllkvllvGlpgvGKttllnrll................ggefai..ygptiginfgtveldg....
00387321   1/1  lkkllkillvGlpgvGKTtllnrllg..................defveygptiginfvtvdlkg.....
00362371   1/1  ----------------------------------------------------------------------
00468241   1/1  ----------------------------------------------------------------------
00470231   1/1  -elaellsllierlllrdlllelkllkvllvGdpnvGKStLlnrl....................kivsd
00465381   1/1  ----------------------------------------------------------------------
00432181   1/1  -slelkkglkvalvGrpgvGKStLlnallg..............lkvaivsdypgttrdptlgvveldgr
00507411   1/1  ----lkvalvGlPNvGKSTLfnaltg...............akaivanypftTrdpnlgvvevdderldl
00482531   1/1  ----------------------------------------------------------------------
00525011   1/1  --kelkvvlvGdpgvGKssLlnrll................ggefvedylpttgddftktvev...dgkt
00378621   1/1  lkkglkvllvGlpgvGKstllnrla.................geef.dtpgttiginfgtveldg.....
00520561   1/1  ----------------------------------------------------------------------
00513761   1/1  ----kiiaivGkgGsGKTTllnklaglladggkvlvidlDparanlpeqlgidirdlidletvmelglgp
00481131   1/1  ----lelkvvlvGdpnvGKssLlnrllg................gkfvsdypgttrdfivktvel...dg
00517841   1/1  -hgegirdlldlidelrdllerldldlpkiavvGrpnvGKSsLlnallgrd..flpvssgpgTtrptelr
00414001   1/1  --rrlllelkmllrvgivGlpNvGKSTLfnaLtgakvaivanyp...............ftTldpnlgvv
00405881   1/1  ---gervglvGrpgaGKSTLlnal.............tglk..aivsgypgttldpnlgvvelddg....
00497591   1/1  ----lkvvlvGrsgvGKStLlnall.......gekvakvsdisatlgrgpgttrdiilikldrg......
00491101   1/1  ----------------------------------------------------------------------
00507751   1/1  -dlkllkvvlvGdpnvGKssLlnrllggk...fvsdyppttgdfivktvei................dgk
00410531   1/1  -------------gvGKTtllkrlag..................gefvdygptigvnfktvevdg.....
00414121   1/1  -kpgevvllvGpsGaGKTTLlrallgll...eglkvaviepdfgeilidgqlledlgvlavrlgigyvpq
00504201   1/1  ----------------------------------------------------------------------
00477011   1/1  -----eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvgggpgtrrptelr
00516461   1/1  ----------------------------------------------------------------------
00356411   1/1  ---------------GKSTllnrllgle.....................ygpTiginegtieidg.....
00519521   1/1  --kelkilllGlpnvGKstllnrllgeefdkp..................gpTrgvnvgtveigg.....
00494041   1/1  -kkeikilllGlgnvGKttllnrllggefdep..................gpTigvnvttftlkg.....
00482521   1/1  ----------------------------------------------------------------------
00495821   1/1  ---------------GKttllnrl....................kfvety.pTigvnfktveidg.....
00475471   1/1  ---------------GKSTLlNaLtg..............ak.aivanypgtTrdpnlgvvelpdgrldl
00520051   1/1  -psrkelklvvvGdsgvGKTsLlnrllg...............gkf.ekyvptvgvdyl.ktvev...dg
00401191   1/1  ----------------------------------------------------------------------
00440861   1/1  MpllslgepllelenlsksyggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKS
00467111   1/1  ---------------GKStLlNaLl.......gekvgfaivs.....gvpgtTrdiwmwivvlieldg..
00450341   1/1  ----------------------------------------------------------------------
00515511   1/1  ---------------GKSTllnrllg.................lefl..pgpTigptegtiei...dg..
00490731   1/1  dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDpyrpaadellgvlaeelgldvllg
00515531   1/1  ---------------GKSTllnrllglefa...................ygpTigptsgtiei...dg..
00379751   1/1  ----------------------------------------------------------------------
00387941   1/1  ---------ladllageadledailetpegldllpaglllagl...ellrgerlrelleel......add
00360951   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           YNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAIELGVEVVPVLNKIDLPQADP
00374071   1/1  tidiaavsfetdg.....rkitliDtPGhvdfikevirglsvadgallvvdavegefeaglsvepqtrev
00411701   1/1  ssatslewelieelllelkldidgkgylinliDTPGhvdFsseveralrvaDgailVvDavegvepqtee
00431331   1/1  slllalvldsldeErergiTidiaavsfetdgrk.....itliDtPGhedfikevirglsvadgallVvd
00362391   1/1  .rlitliDtPGhvdfvkevlrglrvadgailVvdavegvmpqtrehlllarllgvpkiivviNKiDlvda
00372481   1/1  tdg.....rkinliDtPGhedfskevlrglavadgallVvdaadgvspqteevlllarllgvpkiivvlN
00516481   1/1  rergitidsaavsfetdg.....rkinliDtPGhedfvkevlrglrvadgallVvdategvepqtrevll
00396721   1/1  diaavsfetkg.....rkltliDtPGhedfrkevirglrvadgailVvdasdgesfagievepqtrelll
00369581   1/1  .lkitliDtPGhedflkevlrglavadgallVvdategvlpqtrevlllakllgvpniivvlNKiDlvda
00469361   1/1  g.......lnliDtPGhedfrsltlrylrgadgallVvdatdgvsfqtlellelllelgvpiilvlNKiD
00504231   1/1  ..rklnliDtPGhedfsslvlralrvadgallvvdatdgvtpqtlevlllllllgvpiivvlNKiDlvda
00492921   1/1  lllllgklllllllslellkqlnliDtPGhedfssevlralrvadgallVvdatdgvslpqteevlelll
00504491   1/1  ....kgylinliDTPGhvdFseeveralrvlDgavlvvdaveGvepqtetllrlarkygvpiivfiNKmD
00520541   1/1  ....kgylinliDTPGhvdFseeveralrvlDgAvlvvdaveGvevqTetllrqalkygipiivfiNKlD
00517691   1/1  gitidvalarllldg.....rkilllDtPGhedfvkevlralrladgallvvdadegvslpqtrevllll
00357861   1/1  kvklqiwDtaGqerfrslrslyyrgadgvllvyditdgesfeelkkwleellrlapnvpiilvgnKiDll
00401211   1/1  sdtpgttldpilgvleldgpkllllDtPGhedflkellralaladgallvvdadegeflpqtlevlllll
00465511   1/1  .vkltliDtpGlidgapellqedfralvlrylrgadgvllvvdatd.lleqllelleellelgvpiilvl
00520531   1/1  ----------------------------------------------------------------------
00494851   1/1  gttidiklgvl........gvkltliDtpGlgdldviielaerlrdlvreylralrgadgvllvvdatdg
00481801   1/1  vkltliDtpGlidgaseglqedfrslllrylrgadvvllvvdatdglleqdlellellrelgvpiilvlN
00484261   1/1  ..vklnliDtpGqedfrslverylrgfleeadgvllVvdatedregfeeqtkellellrllglllllgvp
00514611   1/1  vklqlwDtaGqerfrslrelyyrgadgvllvvdvtdresfedlkkwleellellepnvpiilvgnKiDlp
00442331   1/1  vklnlwDtpGqedfrslvelylrgadgvllVvdatdresfegvkkwleeilrllplanvpiilvgnKiDl
00471271   1/1  gdfaevgptpgtTrdikvvtv.....egkgvkltliDtpGlgdpaslqeefralvlrylrlrgadavllV
00409841   1/1  r.....dllllDtPGlidfaseptnlldleiieallraleeadvvllvvdadrglleqdlellelllelg
00526911   1/1  vkltliDtpGqedfraellrsylrgadgillVvdatdpesgfeeltkellellrelgllagvpliilvlN
00504821   1/1  ...klvliDtpGlidgaselqedfrkltlrylrgadvvllvvdatdglfeqtlellellrellpgvpiil
00520021   1/1  kvklqiwDtaGqerfrslrelyyrgadgvilvydvtdresfenlkkwleeilellesnvpiilvgnKiDl
00515101   1/1  l.....dg..vkltlvDtpGqedfrrltlrylrgadgvllvvdatdresfegveeqleellellrllgvp
00515821   1/1  tveldg.....vkltlvDtpGqedfrslvlrylrgadgvllVvdatdresfegveeqleellellkllgv
00361531   1/1  vklnliDtpGqeefrslrerylrgadgvllVvdatdgesfeelkewleeilellpladvpiilvgNKiDl
00370451   1/1  vklqlwDtaGqerfrslrelylrgadgvllvvdatdresfedlkkwleeilellpagvpiilvgnKiDll
00527351   1/1  vklqlwDtaGqerfrslrelyyrgadgiilVydvtdresfenlkkwleellellpsnvpiilvgnKiDlp
00514601   1/1  kvklqlwDtaGqerfrslrelyyrgadgvllvydvtdresfenlkkwleellelapsnvpiilvgnKiDl
00488191   1/1  ....tveldg....kltliDtPGlgdllviielaslledfrsltlrylrgadvvllvvdatdglleqtle
00527241   1/1  gklvklqlwDtpGqerfrslrllylrgadgvllVvdatdpesfeglkkwllellellelagvpiilvgnK
00498681   1/1  vkltliDtpGlidpaslqedfrslllrylrgadvillvvdatd.lsfedleklleelrellpellgvpii
00529141   1/1  lvklqlwDtpGqerfrslrllylrgadvvllvvdatdgesfenlkkwllellellelagipiilvgnKiD
00523461   1/1  ..kltliDtpGllltkllegalldllerflrslllsylrgadvvllvvdatdlesfesvllllglkeqll
00528591   1/1  eldg.....vkltlvDtpGqedfrslrlrylrgadgvllVvdatdresfegvekqleellellrllgvpi
00519271   1/1  dg.....vklvlvDtpGqedfraltlrylrgadgvllvvdatdresfegveeqleellelllllgipiil
00507921   1/1  gkkvklqlwDtaGqerfrslrelylrgadgvllVydvtdresfedlkkwleellellelpdvpiilvgnK
00514481   1/1  dg.....vklvlvDtpGqedfrrltlrylrgadgvllvvdatdresfegveeqleellelllllgvpiil
00525021   1/1  lvklqlwDtpGqerfrslrllylrgadgvllVvdatdgesfedlkkwleellellelagvpiilvgnKiD
00517041   1/1  vklqlwDtpGqerfrsllelylrgadvvllvvdatdgesfedlekwleellelleagvpiilvgNKiDll
00526151   1/1  lvlvdgknvklqlwDtaGqerfrslrplyyrgadgvilVydvtdresfenlkkwleellelaelpnvpiv
00399991   1/1  vkltlwDtpGqeefrslrerylrgadgvllVvdatdresfeglkkwleeilellllagvpiilvgNKiDl
00511041   1/1  vklqlwDtpGqerfrslrllylrgadgvllvvdatdpesfeglkkwllellellelagvpiilvgnKiDl
00526801   1/1  vklqlwDtaGqerfrslrelyyrgadgvilVydvtdresfenlkkwleellelapanvpiilvgnKiDll
00504511   1/1  ----------------------------------------------------------------------
00517931   1/1  vkltlvDtpGqerfrslrllylrgadgvllvvdatdrdsfeglkeqllellelllllgvpiilvlNKiDl
00374121   1/1  eldg.....vkltliDtpGqeefrsltlrylrgadgvllVvdasdgdsfeevlelleellellllanvpi
00526251   1/1  vklqlwDtaGqerfrslrelylrgadgvllvvdvtdpesfedlkkwleellelldsnvpiilvgnKiDll
00358141   1/1  vkltlwDtaGqerfrslrelylrgadgvllVvdvtdgesfeelkkwleeilnllpladvpiilvgnKiDl
00531961   1/1  vklqlwDtpGqerfrslrllylrgadvvllVvdatdgesfedlleelleelrellpgvpiilvgNKiDll
00444161   1/1  gktvklqlwDtaGqerfrslrelyyrgadgvllVydvtdresfenlk.kwleeilrllpsgvpiilvgNK
00514621   1/1  vklqlwDtaGqerfrslrelyyrgadgvilVydvtdresfedlkkwleellellepgvpiilvgnKiDll
00514711   1/1  vklqlwDtaGqerfrsltelyyrgadgvllVvdvtdresfenlkkwleellelaedvpiilvgNKiDlld
00528321   1/1  kvtllllqiwDtpGqerf..ltllylrgadvvllvvdatdgesfedlkkwleellellelagvpiilvgN
00514591   1/1  vklqiwDtaGqerfrslrelyyrgadgvilVydvtdresfenlkkwleellelapsnvpiilvgnKiDll
00514501   1/1  vklqlwDtpGqerfrsllelylrgadvvllvvdatdgesfedlkkwleellellgagvpiilvgnKiDll
00511561   1/1  vklvliDtpGlidgalelqerflslrvlrylrgadvvllvvdatdglfeqleellellr..gvpiilvln
00528791   1/1  lvklqlwDtpGqerfrslrllylrgadvvllVvdatdresfedlkewleelleladllagvpiilvgnKi
00481541   1/1  lvklqlwDtpGqerfrslrllylrgadvvllvvdatdgesfeeldeellellrellagvpiilvgnKiDl
00527641   1/1  knvklqlwDtaGqerfrslrplyyrgadgiilVydvtdresfenlkkwleellelldpnvpivlvgnKiD
00463921   1/1  vklqlwDtpGqerfrslrllylrgadvvllvvdatdresfeeldeellellrelgpgvpiilvgnKiDll
00455591   1/1  kvklqlwDtaGqerfrslrelyyrgadgillvydvtdresfeelkkwleeilrllesnvpiilvgnKiDl
00518321   1/1  .dgkkvklqlwDtpGqerfrslrllylrgadvvllVvdatdresfeevdeellellrelglgvpiilvgn
00528411   1/1  gkkvklvlwDtpGqerfrslrllylrgadvvllVvdatdgesfedlkkwleellelleagvpiilvgnKi
00504481   1/1  ----------------------------------------------------------------------
00387311   1/1  vklqlwDtaGqerfrslrelyyrgadgvllvydvtdresfedlkkwleeilrlldpgvpiilvgnKiDll
00515621   1/1  vklqlwDtaGqerfrslwelyyrgadgvilVvdatdrdsfeevkkwleellelallagvpillvgNKiDl
00482541   1/1  ----------------------------------------------------------------------
00362791   1/1  vkltlwDtaGqerfrslrelyyrgadgvllvydvtdresfedlkkwleellkllesgvpiilvgnKiDll
00514581   1/1  vklqlwDtaGqerfrdslrelylrgadvvllvvdatdgesfedlkkwleellellklagvpiilvgnKiD
00449901   1/1  gkkvkltlwDtpGqeefrslrelyyrgadavllvvdatdpesfenlkkwleellelldllllagvpiilv
00514721   1/1  lvklqlwDtpGqerfrslrllylrgadvvllVvdatdgesfeeldewllellrelgpgvpiilvgnKiDl
00424711   1/1  lgnvafksalgglglealldlllellkellellrlslllkkglkvalvGlpnvGKSTLlnaLl.......
00412341   1/1  kkvklqlwDtaGqerfrslrelyyrgadgiilvydvtdresfenlkkwleeilrlldpgvpiilvgnKiD
00402391   1/1  vklqlwDtpGqerfrsltllylrgadgvllVvdasdgdsfeellkwleellelllllgipiilvlNKiDl
00520571   1/1  ----------------------------------------------------------------------
00492691   1/1  lvkltlwDtpGqerfrslrklyyrgaleailllllglllleleeadvvllVvdatdresfeeldlellel
00518311   1/1  klvklqlwDtpGqerfr.ltllylrgadvvllvvdatdresfeglkkwllellellelagvpiilvgnKi
00520981   1/1  kvklqlwDtpGqerfrslrllylrgadvvllvvdatdresfeevdewllellrelglnvpiilvgnKiDl
00525281   1/1  kvklqlwDtaGqerfrslrelyyrgadgvllVvdvtdresfenlkkwleellelleanvpiilvgnKiDl
00527851   1/1  klvklqlwDtpGqerfrslrllylrgadvvllvvdatdresfeeldewllellrelgpgvpiilvgnKiD
00378841   1/1  vklqlwDtaGqerfrsllelyyrgadgillvvdvtdresfeelkkwleeilrlleagvpiilvgnKiDll
00447401   1/1  vklllwDtpGqeefrsllelylrgadgvllVvdatdpesfenlkkwleellellgllllagvpiilvgnK
00396701   1/1  ----------------------------------------------------------------------
00407471   1/1  vkltlvDtpGqerfrslwlrylegadavilvvdasdpdsfeelkelleellellllagvpiilvlNKiDl
00372461   1/1  ----------------------------------------------------------------------
00403151   1/1  lvkltlwDtaGqerfrslrelyyrgadgvllvydvtdresfenvlswleelrellgllllegvpillvgn
00352811   1/1  ..vkftiwDtgGqrdfrklwilyfegadaiifVvdssdydsflnvdkwtnrleealellesillnrllkn
00410321   1/1  vklqlwDtaGqerfrsllllylrgadgvllVvdatdgdsfeevkellleilelaglagvpiilvgNKiDl
00504521   1/1  ----------------------------------------------------------------------
00366991   1/1  vklqlwDtaGqerfrslwllylrgadgillVvdatdgdsfeevakwleellnlagladvpillvgnKiDl
00374051   1/1  ----------------------------------------------------------------------
00444821   1/1  .vklqlwDtaGqerfrslwllylrgadavllVvdatdgdsfeelkellleilellllagvpiilvgNKiD
00387321   1/1  vklqlwDtaGqerfrslwllyyrgadgillVvdatdgdsfeevaklleeilelaglenvpiilvgNKiDl
00362371   1/1  ----------------------------------------------------------------------
00468241   1/1  ----------------------------------------------------------------------
00470231   1/1  pgtTigv.vgtveldg.....vklqlwDtaGqerfrsltlrylrgadavllVvDasdydlvllepdsfer
00465381   1/1  ----------------------------------------------------------------------
00432181   1/1  .....klvliDtpGleefasggekqrvalalallreadvlllvvdadeptsfldlellellrelllagkp
00507411   1/1  laelslkpalgvkpkkivpakivlvDtpGlikgaslgeglgnqflaaireadvillVvDasegltliihv
00482531   1/1  ----------------------------------------------------------------------
00525011   1/1  vklqiwDtaGqerfrsltelyyrgadgvllvydvtdresfedlkkwleellelldllsnvpiilvgnKiD
00378621   1/1  vklqlwDtpGqerfrsltlrylenadvvllvvdasdpdsfeellelleellellllagvpiilvlNKiDl
00520561   1/1  ----------------------------------------------------------------------
00513761   1/1  ngalvfaleellt.tld................illealelleedydyiliDtpGglelrallalllaia
00481131   1/1  klvklqlwDtaGqerfrsllelylrgadvvllVvdatdresfeeldeelleelrelaagvpiilvgnKiD
00517841   1/1  lgespellaeflidggekltdldelrkeieeatdallgpgkgfsfdtieleielpdlp..nltlvDtPGl
00414001   1/1  elpderldllaglakpkklvgapvvlvDtpGliegaslgeglgrqflaaleeadvilhVvdasdplgiil
00405881   1/1  rqlvlvDtpGlielaslgeglvrqalealeradvillvvdasdplldqpvellsggekqrlalarallgk
00497591   1/1  ..llliDtPGirefglldeeaveltllylegadllllvvdathg.fepdcavlealeeggipiilvlnki
00491101   1/1  ----------------------------------------------------------------------
00507751   1/1  lvklqlwDtaGqerfrslrllylrgadvvllvvdvtdresfedlkkwleeilellelagvpiilvgnKiD
00410531   1/1  vklviwDtaGqerfrsllarylrgadgillvvdatdglsfeevaklleellglaglegvpiilvgnKlDl
00414121   1/1  tlglfpaltvlellalalllredpdlilidsgGqkqrlalaralladpdlgellllDeptlvlDaasged
00504201   1/1  ----------------------------------------------------------------------
00477011   1/1  lsetpgltvlvvflelgerldllglvfqdfsllpelielenralagpiagisrdairleielpglp....
00516461   1/1  ----------------------------------------------------------------------
00356411   1/1  vkltlwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlenvp
00519521   1/1  vkfrlwDtgGqrrfrklwllyfedadaiifvvDasdydqvlledelrnrleellelleeilnllllagkp
00494041   1/1  vklqlwDtgGqerfrslwelyfegadaiifvvdlsdgdsflnldkwlnrleeslellesilnllllanvp
00482521   1/1  ----------------------------------------------------------------------
00495821   1/1  vklqiwDtaGqerfrslwllyyrgadaiifVvDlsdrdqvlledelvnsfeevlewleellnnallanvp
00475471   1/1  laelvkpkkivpapivlvDtpGliegasegeglgnqflaaireadvilhvvdasegltivhveglvdplr
00520051   1/1  klvrlqlwDtpGqerfr.....yyrgadgvllvfdlsdpesfenlkkwlkellellglllpgipillvgt
00401191   1/1  ----------------------------------------------------------------------
00440861   1/1  tLlnaLlgllkpdegvilvggk.gvTrdivlytledg........................vkltliDtp
00467111   1/1  rpllliDTpGlgdtekedekelvkiallallladvvllvvd..ggiteqdlellklllelgkplilvlnK
00450341   1/1  ----------------------------------------------------------------------
00515511   1/1  vklqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenlanvp
00490731   1/1  arggdlsggl....rqrlarallgdydvliiDtpgtldvllelallellkellaelgadvvllvvdatlg
00515531   1/1  vklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenlanvp
00379751   1/1  ----------------------------------------------------------------------
00387941   1/1  yDvviiDtppgl..gdltllalaaadgvllVvdpellalraarrllellrklglpllgvvlNkvdprar.
00360951   1/1  ----liDtppglgdlglltlaallaadgvliVttpealslqdalrllelleklkdnpglpvlgvvlNkvd


                         +         -         -         -         -         *         -:210
query           ANAIQEIEDVIGIDAQDATPCSAKTGQGVEDVIEALIAKVPPPKGDAAAPLQALIIDSWFDNYVGVVMLV
00374071   1/1  lllalllgvphiivviNKiDlvdadeerlleileellellkklgylpigvpvvpvsaltgegvdel----
00411701   1/1  vlrqarkegipiilviNKiDrlgadlllvleelyeklsrlieevnviisglnddllgkllvsplqgpvvf
00431331   1/1  asegvlerllelepqtrevlllalllgvphiivviNKiDlldadpleellee------------------
00362391   1/1  derlelvveellellkklglllelvpvvpvSaltgegvdelldallellpspe-----------------
00372481   1/1  KiDlldadelleevkeelrellkllgllledvpvvpiSaltgegvdelldallellpvpe----------
00516481   1/1  larllgvpriivvvNKiDlvgadeerleevleeieellkllglvpldvpivpvsaltg------------
00396721   1/1  larllgvphiivviNKiDlldadeleevleeieeelgellaklgfplgdvpvvpv---------------
00369581   1/1  eerleevleelrellkllgllgelvpvvpiSaltgegvdelldalvellplpl-----------------
00469361   1/1  lvdadeleeleellkklglplelvpllldllldsllldllllgllssllle-------------------
00504231   1/1  drleevleeleellkllllpldvpivpisaltgegvdelleailel------------------------
00492921   1/1  elgvpniivvlNKiDlvdadrleevleeleellkelgfldvpiv--------------------------
00504491   1/1  rpg.dflelleeirellglllplqlpigsgsdfvgvvdllse----------------------------
00520541   1/1  rlgadllelleeieerlgllvvplqlpigfgsgflgvvdlls----------------------------
00517691   1/1  lllgvpniivvlNKiDlvdaeeleevleelrellkllglplvpv--------------------------
00357861   1/1  dareveealelakelgl...pffetSAktgegveelfealvklilepkllleklletllllrvllelllk
00401211   1/1  elgvkpiilvlNKiDlvdaelleevleeleellkllgllnvp----------------------------
00465511   1/1  NKiDlldarevsleeleelakklgl..vpvvevsaktgegvdelleall---------------------
00520531   1/1  ------------------------tglGveeLldaivdllpsPkadpdgplqalvfkivydpyvgriafv
00494851   1/1  lfeqdlellklllelgvpiilvlNKiDlldeaelevlleelrel--------------------------
00481801   1/1  KiDlld.vlleeleellkelglpp..vvpvsaktgegvdelleallel----------------------
00484261   1/1  iilvlNKiDlldareveevleelkeelkalakelglpigl------------------------------
00514611   1/1  earevseeealelakelgl.pfietSaktgegvdelfeala-----------------------------
00442331   1/1  learevseeealelakelgl.pvvetSaktgegvdelfeallklllep----------------------
00471271   1/1  vdatdpglfeqdlellkellelfgelagvpiilvlNKiDlldaeev------------------------
00409841   1/1  kpvilvlNKiDlldaeell.leevleellkllaelggvpvvpiSa-------------------------
00526911   1/1  KiDlldareveelleelreelkklakelglllellllllell----------------------------
00504821   1/1  vlNKiDlld.drevlleelrellg..lvpvvevsaktgegvdelfeall---------------------
00520021   1/1  pearevseeealelakelgl.pfietSAktgegveelfealvrlllep----------------------
00515101   1/1  iilvlNKiDlldaeelrevseelaellakllgipvvetsak-----------------------------
00515821   1/1  piilvlNKiDlldaeelrevleelaellakelgipvvetSa-----------------------------
00361531   1/1  le..revleeeaeelakelglpvvetSaktgegvdelfealle---------------------------
00370451   1/1  dalslrevseeealelakelglpfietSaktgegvdelfealv---------------------------
00527351   1/1  earevseeealelakelgl.pfietSaktgegvdelfealvkll--------------------------
00514601   1/1  pearevseeealelakelgl.pffetSaktgegvdelfealve---------------------------
00488191   1/1  lleellelgvpiilvlNKiDlldaeeleevveeleelll-------------------------------
00527241   1/1  iDlle.erevsleellelakelglpvvetSaktgegvdelfealae------------------------
00498681   1/1  lvlNKiDlldaeeleelkellkllgi...pvvevsaktgegvdelleallell-----------------
00529141   1/1  llearevsleellelakelgl.pvievSaktgegvdelfealaelll-----------------------
00523461   1/1  ellkllellgvpiilvlnKiDll.adaeeveellaellellgl---------------------------
00528591   1/1  ilvlNKiDlleareveellaelellllllllgllllelaeelgi..------------------------
00519271   1/1  vlNKiDlldaldlrevleelaellakelgipvvetSaktgegvde-------------------------
00507921   1/1  iDlld..revseeealelakelglpfietSaktgegvdelfealvelll---------------------
00514481   1/1  vlnKiDlldareleevleelaellalllgipvvevsak--------------------------------
00525021   1/1  lle.erevsleellelakelglpvvetSaktgegvdelfealael-------------------------
00517041   1/1  darevsleealelakelglp.vietSaktgegvdelfealaellle------------------------
00526151   1/1  lvgNKiDlpdarevseeeaeelakelgl...pffetSAktgegveelfe---------------------
00399991   1/1  leerevsleealelaeelgl.pvvetSaktgegvdelfeallk---------------------------
00511041   1/1  le.drevsleellelakelgipvvetSaktgegvdelfealv----------------------------
00526801   1/1  earevseeealelakelgl.pfietSaktgegvdelfealv-----------------------------
00504511   1/1  ----------------------------------------------------------------------
00517931   1/1  ldalelrevleelaealakelgipvietSaktgegvdelfea----------------------------
00374121   1/1  ilvlNKiDlldareleellellellllllvsteealelaee-----------------------------
00526251   1/1  earevseeealelakelgl.pfietSaktgegvdelfealaellleplll--------------------
00358141   1/1  leerevseeeglelakelglipfvetSaktgegvdelfeall----------------------------
00531961   1/1  darellellellelglvsleellelakelgavpvvetSaktgegvdelfealaell--------------
00444161   1/1  iDllderevskeearelakelgl...pfvetSAktgegvdelfe--------------------------
00514621   1/1  darevseeealelakelgl.pfietSaktgegvdelfealak----------------------------
00514711   1/1  arevseeealelakelgl.pvfetSaktgegvdelfealael----------------------------
00528321   1/1  KiDlled.revsleellelakelgipvietSaktgegvdelfeala------------------------
00514591   1/1  darevseeealelakelgl.pffetSaktgegveelfealakl---------------------------
00514501   1/1  ear.evsleellelakelglpvvetSaktgegvdelfealael---------------------------
00511561   1/1  KiDlldarellell....lalllglpvvevsaktgegv--------------------------------
00528791   1/1  Dlld..revlleeleelakelglpvvetSaktgegvdelfeala....klea------------------
00481541   1/1  ldarellellellglllvsleealelakelgavpvvetSaktgeg-------------------------
00527641   1/1  lpda.revseeealelakelglpffetSaktgegveelfealvrli------------------------
00463921   1/1  darellellellglllvsleellelakelgavpvvetSaktgegv-------------------------
00455591   1/1  lderevskeealelakelgl.pfletSaktgegvdelfealve---------------------------
00518321   1/1  KiDlldarellellellglllvsleealelakelgavpvvetSakt------------------------
00528411   1/1  Dlldarevsleellelakelgl.pvietSaktgegvdelfea----------------------------
00504481   1/1  -----------------------------------------pPkgdpdkpllalvfkvfydpyrGrvalv
00387311   1/1  eerevseeealelakelgl.pfvetSaktgegvdelfeal------------------------------
00515621   1/1  ldalslrevseeealelakelgipvfetSAktgegvdelfe-----------------------------
00482541   1/1  ----------------------------------------------------------------------
00362791   1/1  darevseeealelakelgl.pfletSAktgegvdelfell------------------------------
00514581   1/1  llearevsleellelakelglp.vietSakdsetgeg---------------------------------
00449901   1/1  gnKiDll..erevlleeleelakelglvpfvetSaktgegvde---------------------------
00514721   1/1  ldarellellellglglvsleealelakelglvpvvetSakt----------------------------
00424711   1/1  ....gakvaivsdip...gtTrdivlgvl.....gkk.--------------------------------
00412341   1/1  lleerevseeealelakelgl.pfvetSAktgegvdelfe------------------------------
00402391   1/1  ldalslrevleelalelakllgipvfetSaktgegvdelfdal---------------------------
00520571   1/1  ----------------------------------------------------------------------
00492691   1/1  lrellpgvpiilvgNKiDlldarellelllllglllvsleeile--------------------------
00518311   1/1  Dlld.erevsleellelakelglpvietSaktgegnvdelfeala-------------------------
00520981   1/1  ldarellellellglllvsleealelakelgavpvvetSak-----------------------------
00525281   1/1  learevseeealelakelgl.pffetSaktgegvdelfealaell-------------------------
00527851   1/1  lldalsllellsllglrevlleealelakelglvpvvetSaktgegv-----------------------
00378841   1/1  g..rqvlveearalakelgiplfetSaktgegvdelfealvkll--------------------------
00447401   1/1  iDlld..revleelaealakelggipvvetSaktgegvdelfealv------------------------
00396701   1/1  ---------------------------------------------dldkplralvidvfldsgvgtvatg
00407471   1/1  ldakllaellellrlvlleellllalllgipvvetSAktg------------------------------
00372461   1/1  ------------------------------------------Perdldkplrllvqdvfkdsgvgtvatg
00403151   1/1  KlDlptnerdvsleealelalelgllpvievSaktgegvdelfel-------------------------
00352811   1/1  vpiilvlNKiDlleeksveeilelleyfpdylgllklldlllll--------------------------
00410321   1/1  lealgarevseelalelakelgip...vvetSAktgegvdelfd--------------------------
00504521   1/1  ----------------------------------------------------------------------
00366991   1/1  lealsarevseeealelakelgipfvetSAktgegvdelfe-----------------------------
00374051   1/1  -----------------------------------------------dkplrllvqdvfkisgvgtvvtg
00444821   1/1  llealslrevseelalelakllgipvfetSAktgegvdelfeal--------------------------
00387321   1/1  ldalllrevleelglelakelgip...ffetSAktgegvdelfe--------------------------
00362371   1/1  -------------------------------------------krdldkplrllvldvflisgrGtvvtg
00468241   1/1  ----------------------------------------------------------------------
00470231   1/1  leewleelrellanpllanvpiilvgNKiDl........le-----------------------------
00465381   1/1  ---------------------------------------------dldkplrllvqdvfkisgvGtvvtg
00432181   1/1  vilvlnKiDlldar.....eelakllgvp...vvevSaktgegvd-------------------------
00507411   1/1  egsvdPvedieiietELiladlellekrleklekkaklggkkllltlalkllkaelklllvilelleagl
00482531   1/1  ----------------------------------------------------------------------
00525011   1/1  llderevseeealelakelgl.pfietSAktgegvdelfealaelll-----------------------
00378621   1/1  ldaallrevleelalelakllgip.vvetSAktgegvdel------------------------------
00520561   1/1  ----------------------------------------------------------------------
00513761   1/1  ralaadeillvddptsgldaetqleilelllelllklgipiil---------------------------
00481131   1/1  lldalsllllllllglrevlleealelakelglvpvietSaktge-------------------------
00517841   1/1  gsaavgdqpeeleeafraltleylreadtlillvvdas--------------------------------
00414001   1/1  vvnkvdpledieiisaelgladlellekllealirrpnsgk-----------------------------
00405881   1/1  pvilvlNKiDep...tneldlellelleelggtvvlvSahd-----------------------------
00497591   1/1  Dll-------------------------------------------------------------------
00491101   1/1  -----------------------------------------pPerdldkplrlpvqdvf..kgvgtvvtG
00507751   1/1  llearevsleealelakelgl...pfietSaktlgegvdelfea--------------------------
00410531   1/1  ldalllrevsaelalelakelgik.fietSAktgegvdelfefl--------------------------
00414121   1/1  lldllkela.eqlgltvlivlnKiDlls.elthdlellreladril------------------------
00504201   1/1  --------------------------------------------rdldkplrlpvqdvfkisgvgtvvtg
00477011   1/1  dltlvDtPGlgsvavvdqlsggqkqrvalarallknpd--------------------------------
00516461   1/1  --------------------------------------------rdldkplrlpvqdvfrisgvgtvvtg
00356411   1/1  iilvlNKiDlleekiveellellgleykgdrdpeelsggqk-----------------------------
00519521   1/1  illvlNKiDlldekllael..ledlfpeykglnndleaaleyilsk------------------------
00494041   1/1  illvgNKiDlleaklleellkllfpeydglndledalkfievsfel------------------------
00482521   1/1  ------lpataeqlrvpvlygsaldgkgvq..........plldadpdgplvalvsklvadpdvgrflaf
00495821   1/1  illvgNKiDl...........leelakklglkvfetsakt------------------------------
00475471   1/1  dieiilleliladlellekrleklgklakggvkdllealell----------------------------
00520051   1/1  K.Dlledldlrevsleealelakelggvpyfetsaktgegvdelfdelar--------------------
00401191   1/1  ------------------------------------------Perdldkplrlpvqdvfdingpgtdldd
00440861   1/1  Glgdtklsdeeklilkyleeadlvllvid.d.gltel---------------------------------
00467111   1/1  wDllekeeleellkelkplllflvrdfapvlfisaltgtgl-----------------------------
00450341   1/1  -----------------------------------------lPerdedkpfrlpvqdvfkisg.gtvagg
00515511   1/1  illvlnKiDlleaklvllllvglfdlldglpselsggqkqrva---------------------------
00490731   1/1  leaadr.ilvlleglgvp.gvvlNkldlvaeg..gaalelleelgvp-----------------------
00515531   1/1  illvlnKiDlleakera...eellellgl..gdlldk---------------------------------
00379751   1/1  ----------------------------------------------vvfPlrlpildvfvingvgtvvvG
00387941   1/1  .eelleelaeelglp-------------------------------------------------------
00360951   1/1  lrte..ggvleelaeelglpvlgvipldeavreaallgep------------------------------


                         -         -         -         +         -         -         -:280
query           RVVNGTLRPKDKVLLMATGAQHLVEQVGVFSPKSIQRDELTAGQVGFVIAGIKELKAAKVGDTITTMTRR
00374071   1/1  ----------------------------------------------------------------------
00411701   1/1  gsaltgvgfllllfallyak--------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00520541   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00357861   1/1  avllsd----------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00520531   1/1  rvysGtlkkgdkvlllrtgkkekvgrllvflglkreevdealaGdivavv....glkdikvgdtltdaen
00494851   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00504511   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00504481   1/1  rvysGtlkkgdkvllv..gkkvrvgellvflglereevdealaGdivaiv....glkdirvGdtltdpen
00387311   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00482541   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00520571   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00396701   1/1  rvesGtlkvgdkvvvlpsgktgrvksllvfke...dvdealaGdivgillkgvglkdikvGdtltapenp
00407471   1/1  ----------------------------------------------------------------------
00372461   1/1  rvesGtlkvgdkvrvlgtlpsvlvgevksllrfredvdeavaGdivglllkgvglkdikrGdvltdpenp
00403151   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00504521   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00374051   1/1  rvesGvvkvgdkvlvlpsgktvevksievf...reevdealaGdivglllkgvdlkdirrGdvltdpgnp
00444821   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00362371   1/1  rvesGvlkvgdkvvllpsgviltgkvksiemfk.kdvdealagdivglllkgigledvrrGdvltvpgnp
00468241   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00465381   1/1  rvesGvikvgdkvlilpsgkvlkvkvksievf.rkevdeavaGdivglllkgvdledirrGdvltdpg--
00432181   1/1  ----------------------------------------------------------------------
00507411   1/1  plrsld----------------------------------------------------------------
00482531   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00520561   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00491101   1/1  rvesGvvkvgdevlvlpsgkttkv..ksiemldkveldeavaGdnvgllllgie..edisrGdvlvdpgn
00507751   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00504201   1/1  rvesGvikvgdevrvlpsglttkvksievf...kedvdeavagdnvglllkgvdvedisrGdvlvdpgn-
00477011   1/1  ----------------------------------------------------------------------
00516461   1/1  rvesGvlkvgdevlvlpsgktvrvksievfde...eveeavagdivgltlkgv...edisrGdvlvdpdn
00356411   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00482521   1/1  gRvysGtlkkGdkvrvlgpgyspgdeedlkkvrvgrlllfmgrereevdeapaGdivai....vglddai
00495821   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00401191   1/1  lrGvVvtgrvesGvlkvGdeveilpllllkeggkllllglttkvksievf.....rkeleealagdlvgl
00440861   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00450341   1/1  rvesGvikvgdkvrvlpsg..gkvkslerfked...veeAvaGdevglllegii..edikrGdvllapg-
00515511   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00379751   1/1  vrVlsGvlkvgdpvlvlpggkvgevkslern...kedvkearaGdevaialkgvtvgrdikrgdvlyvle
00387941   1/1  ----------------------------------------------------------------------
00360951   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AEAPLPGFKEVKPQVFAGLYPVESNQYEALRESLEKLRLNDASLQFEPEVSQALGFGFRCGFLGLLHMEI
00374071   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00520541   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00520531   1/1  pvalpllg--------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00504511   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00504481   1/1  plalellgf-------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00482541   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00520571   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00372461   1/1  pp--------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00504521   1/1  ---------vpePvlsvaiepkdssdlgklleaLeklaeedpslrvevdee...tgelilsglGelhlei
00366991   1/1  ----------------------------------------------------------------------
00374051   1/1  pplp------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00362371   1/1  pP--------------------------------------------------------------------
00468241   1/1  ---------fpePvlfvavepkdpsdlkkllkaLekLaeedpslvvevdee...tgelilgglGelhlev
00470231   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00482531   1/1  -------lpfpePvlfvavepkdksdleklleaLeklaeedpsllvevdetg....elilgglGelhlev
00525011   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00520561   1/1  ---------fpePvlfvavepkdpsdlkkllkaLekLaeedpslvvevd...eetgelilgglGelhlev
00513761   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00491101   1/1  p---------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00504201   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00516461   1/1  p---------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00482521   1/1  ikgdtl----------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00401191   1/1  llk-------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00379751   1/1  sres........advlilvlredltlgdlpllhillkllaied---------------------------
00387941   1/1  ----------------------------------------------------------------------
00360951   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VQERLEREFDMDLITTAPTVVYQVQQRDGTVLTVENPAKMPDPSKIEAILEPIVTVNLYMPQDYVGSVMT
00374071   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00520541   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00520531   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00504511   1/1  -----------------------------------------------vllEPivkveilvpeeylgdvig
00517931   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00504481   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00482541   1/1  --------------------------------------------------EPimlveilvpeeylgdvig
00362791   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00520571   1/1  -----------------------------------------------vllEPivkveilvpeeylgdvig
00492691   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00372461   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00504521   1/1  llerL.reygvevivskprV--------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00468241   1/1  llerLkreygvevilgapsva-------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00482531   1/1  vlerLereyagvevilseP---------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00520561   1/1  llerLkreygvevilge-----------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00504201   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00482521   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00401191   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00360951   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LCTQKRGAQINMSYHGKQVQLTYEIPMAEIVMDFFDRLKSVSRGYASMDYEFKEYRQSDVVKVDILINSD
00374071   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00520541   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00520531   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00504511   1/1  llskrrGeilgmellgglvvlealvPlael.fgfateLrslTsGraslslefsgyepvpgdlldilingv
00517931   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00504481   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00482541   1/1  llnkRrGeilgmelldgtglvlikalvPlael.fgfateLrslTsGrasfslefdhyepvpgdildrlig
00362791   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00520571   1/1  llskrrGeilgmellgglvvlealvPlael.fgfateLrslTsGraslslefsgyep.........vpgd
00492691   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00372461   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00504521   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00468241   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00482531   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00520561   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00504201   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00482521   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00401191   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00360951   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           KVDALSVIVHRSNSQYRGREVAAKMREIIPRQMYDVAIQAAIGSNIIARENVKALRKNVLAKCYGGDISR
00374071   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00520541   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00520531   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00504511   1/1  lvda------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00504481   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00482541   1/1  elellesgealkyallalqdrgelfv--------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00520571   1/1  lvdel-----------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00372461   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00504521   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00468241   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00482531   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00520561   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00504201   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00482521   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00401191   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00360951   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           KKKLLEKQKAGKKRMKQVGTVEIPQEAFLAILQVDDK---------------------------------
00374071   1/1  ----------------------------------------------------------------------
00411701   1/1  ----------------------------------------------------------------------
00431331   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00516481   1/1  ----------------------------------------------------------------------
00396721   1/1  ----------------------------------------------------------------------
00369581   1/1  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00504231   1/1  ----------------------------------------------------------------------
00492921   1/1  ----------------------------------------------------------------------
00504491   1/1  ----------------------------------------------------------------------
00520541   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00465511   1/1  ----------------------------------------------------------------------
00520531   1/1  ----------------------------------------------------------------------
00494851   1/1  ----------------------------------------------------------------------
00481801   1/1  ----------------------------------------------------------------------
00484261   1/1  ----------------------------------------------------------------------
00514611   1/1  ----------------------------------------------------------------------
00442331   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00504821   1/1  ----------------------------------------------------------------------
00520021   1/1  ----------------------------------------------------------------------
00515101   1/1  ----------------------------------------------------------------------
00515821   1/1  ----------------------------------------------------------------------
00361531   1/1  ----------------------------------------------------------------------
00370451   1/1  ----------------------------------------------------------------------
00527351   1/1  ----------------------------------------------------------------------
00514601   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00527241   1/1  ----------------------------------------------------------------------
00498681   1/1  ----------------------------------------------------------------------
00529141   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00528591   1/1  ----------------------------------------------------------------------
00519271   1/1  ----------------------------------------------------------------------
00507921   1/1  ----------------------------------------------------------------------
00514481   1/1  ----------------------------------------------------------------------
00525021   1/1  ----------------------------------------------------------------------
00517041   1/1  ----------------------------------------------------------------------
00526151   1/1  ----------------------------------------------------------------------
00399991   1/1  ----------------------------------------------------------------------
00511041   1/1  ----------------------------------------------------------------------
00526801   1/1  ----------------------------------------------------------------------
00504511   1/1  ----------------------------------------------------------------------
00517931   1/1  ----------------------------------------------------------------------
00374121   1/1  ----------------------------------------------------------------------
00526251   1/1  ----------------------------------------------------------------------
00358141   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------
00444161   1/1  ----------------------------------------------------------------------
00514621   1/1  ----------------------------------------------------------------------
00514711   1/1  ----------------------------------------------------------------------
00528321   1/1  ----------------------------------------------------------------------
00514591   1/1  ----------------------------------------------------------------------
00514501   1/1  ----------------------------------------------------------------------
00511561   1/1  ----------------------------------------------------------------------
00528791   1/1  ----------------------------------------------------------------------
00481541   1/1  ----------------------------------------------------------------------
00527641   1/1  ----------------------------------------------------------------------
00463921   1/1  ----------------------------------------------------------------------
00455591   1/1  ----------------------------------------------------------------------
00518321   1/1  ----------------------------------------------------------------------
00528411   1/1  ----------------------------------------------------------------------
00504481   1/1  ----------------------------------------------------------------------
00387311   1/1  ----------------------------------------------------------------------
00515621   1/1  ----------------------------------------------------------------------
00482541   1/1  ----------------------------------------------------------------------
00362791   1/1  ----------------------------------------------------------------------
00514581   1/1  ----------------------------------------------------------------------
00449901   1/1  ----------------------------------------------------------------------
00514721   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00412341   1/1  ----------------------------------------------------------------------
00402391   1/1  ----------------------------------------------------------------------
00520571   1/1  ----------------------------------------------------------------------
00492691   1/1  ----------------------------------------------------------------------
00518311   1/1  ----------------------------------------------------------------------
00520981   1/1  ----------------------------------------------------------------------
00525281   1/1  ----------------------------------------------------------------------
00527851   1/1  ----------------------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00396701   1/1  ----------------------------------------------------------------------
00407471   1/1  ----------------------------------------------------------------------
00372461   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00352811   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00504521   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00374051   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00362371   1/1  ----------------------------------------------------------------------
00468241   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00465381   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00507411   1/1  ----------------------------------------------------------------------
00482531   1/1  ----------------------------------------------------------------------
00525011   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00520561   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00481131   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00497591   1/1  ----------------------------------------------------------------------
00491101   1/1  ----------------------------------------------------------------------
00507751   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00504201   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00516461   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00519521   1/1  ----------------------------------------------------------------------
00494041   1/1  ----------------------------------------------------------------------
00482521   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------
00475471   1/1  ----------------------------------------------------------------------
00520051   1/1  ----------------------------------------------------------------------
00401191   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00450341   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00379751   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00360951   1/1  ----------------------------------------------------------------------