[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF09433.1


[Show Plain Result]

## Summary of Sequence Search
   1::278
 102::272  3.8e-24 23.7% 0045815 00458151 1/1   uclease H-like                          
 109::270  4.2e-24 24.8% 0046085 00460851 1/1   uclease H-like                          
 103::278  5.8e-24 22.2% 0046055 00460551 1/1   uclease H-like                          
 107::279  7.3e-18 24.4% 0045929 00459291 1/1   uclease H-like                          
 183::227  0.00016 38.1% 0035416 00354161 1/1   uclease H-like                          
   1::278


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKTVCDVLGVARSAVAAKQARSSEWRDGRRARQYDDTALVAEIHELVAGLPTYGYRRVWALLRRSHELSG
00458151   1/1  ----------------------------------------------------------------------
00460851   1/1  ----------------------------------------------------------------------
00460551   1/1  ----------------------------------------------------------------------
00459291   1/1  ----------------------------------------------------------------------
00354161   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ASPVNAKRVYRVMHDHQLLLRRPGRRLDTRRHDGRVAVDRSNTRWCSDGFEFRCDDGSPLRVTFALDCHD
00458151   1/1  -------------------------------llrlfratrpnelwhiDitgpptlggrky.llvviDdfs
00460851   1/1  --------------------------------------daPnelwhiDltgl.....gkkyllvvvDdfs
00460551   1/1  --------------------------------gplfratrpnelwhiDitplptsggkly.llvviDdfs
00459291   1/1  ------------------------------------ealaPnevwsgDghyldvfvrhpdgkvgrpylta
00354161   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           REAISWAATTGGHSGDIVRDVMLAAVEQRFGAVQTEQTIEWLSDNGSAYIDHRTRSFARELGLEPLTTPV
00458151   1/1  ryvvaipls..sltaelvakal.erafarfg.....vpkiihsDnGseFtskafrellaelgikhslsrp
00460851   1/1  ryvvayplk..setaelvakflle.iiarfg......pkvihsDnGseFtskefkellaelgikhsfsrp
00460551   1/1  ryvvayplk..sktaelvakalkr.iiarfg.....vpkvihsDnGseftskafqellkelgikhsfsrp
00459291   1/1  iiDvySrkivgwrlslse.nadlvvdalrdaiar.yGi...pellilytDnGseytskaftgglknryrf
00354161   1/1  ------------------------------------------tDnGpeftskefeefckelgikhttgiP


                         -         -         -         +         -         -         -:280
query           RSPQSNGMAESFVKTMKRDYIAFMNKPDVPTALSQLTVAFEQYNDWHPHKALKYRSPREFRRAATSST--
00458151   1/1  gnpqdngvvErfnrtlkeelrklllfas..........liefynhrrwhealgtatpalnrt--------
00460851   1/1  ytPqqnGvvErfnrtlkeelrklll..sleewrealltalylynr.rphsslggltPael----------
00460551   1/1  ytpqqngvvErfnrtlkeelrklllesglglllpleewrealptalyayNr.rphsslg.ltPfe...--
00459291   1/1  kvldddplgllarlGidvifaipyspqgngqakpiErlfrtlkyelvylklprlagaytGgnpdakper-
00354161   1/1  ynPqsnGvvEraNrtlk-----------------------------------------------------