[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF09441.1


[Show Plain Result]

## Summary of Sequence Search
   1::634
 137::428  7.6e-74 40.7% 0050677 00506771 1/1   p containing nucleoside triphosphate hy 
  80::422  8.7e-68 38.1% 0052004 00520041 1/1   p containing nucleoside triphosphate hy 
  29::275  4.9e-67 44.9% 0050691 00506911 1/2   p containing nucleoside triphosphate hy 
  33::276  5.7e-64 46.4% 0053146 00531461 1/2   p containing nucleoside triphosphate hy 
  49::275  6.4e-64 42.7% 0042553 00425531 1/2   p containing nucleoside triphosphate hy 
  38::276  2.7e-63 46.1% 0052855 00528551 1/2   p containing nucleoside triphosphate hy 
  49::276  5.1e-61 48.1% 0049300 00493001 1/2   p containing nucleoside triphosphate hy 
  51::425  1.1e-57 44.9% 0041442 00414421 1/1   p containing nucleoside triphosphate hy 
  49::274  1.2e-56 40.0% 0043901 00439011 1/2   p containing nucleoside triphosphate hy 
  47::273  1.7e-56 44.2% 0044714 00447141 1/2   p containing nucleoside triphosphate hy 
  40::273  2.3e-54 38.4% 0042720 00427201 1/2   p containing nucleoside triphosphate hy 
 210::430  7.9e-54 36.9% 0051498 00514981 1/1   p containing nucleoside triphosphate hy 
 211::422  8.2e-54 45.0% 0052795 00527951 1/1   p containing nucleoside triphosphate hy 
  46::276  1.1e-52 39.1% 0038740 00387401 1/2   p containing nucleoside triphosphate hy 
 249::444  5.3e-52 42.2% 0034833 00348332 2/2   p containing nucleoside triphosphate hy 
  30::275  3.5e-51 41.0% 0048111 00481111 1/1   p containing nucleoside triphosphate hy 
 282::460  4.4e-51 37.6% 0052549 00525492 2/2   p containing nucleoside triphosphate hy 
  48::276  9.6e-51 42.1% 0042088 00420881 1/2   p containing nucleoside triphosphate hy 
   3::277  2.8e-50 39.9% 0038151 00381511 1/2   p containing nucleoside triphosphate hy 
 279::439  5.9e-50 37.3% 0052823 00528232 2/2   p containing nucleoside triphosphate hy 
  50::277  6.5e-50 41.7% 0038141 00381411 1/2   p containing nucleoside triphosphate hy 
  86::448  8.3e-50 42.7% 0038163 00381631 1/1   p containing nucleoside triphosphate hy 
 277::444  1.6e-48 37.5% 0053147 00531472 2/2   p containing nucleoside triphosphate hy 
 280::480  4.8e-48 31.5% 0042089 00420892 2/2   p containing nucleoside triphosphate hy 
 278::443    2e-46 39.4% 0049301 00493011 1/1   p containing nucleoside triphosphate hy 
  50::272  9.3e-46 34.9% 0043258 00432581 1/2   p containing nucleoside triphosphate hy 
 249::447  1.5e-45 41.5% 0036155 00361552 2/2   p containing nucleoside triphosphate hy 
  85::445  4.1e-45 44.6% 0035849 00358491 1/1   p containing nucleoside triphosphate hy 
  85::455  4.4e-45 41.5% 0036318 00363181 1/1   p containing nucleoside triphosphate hy 
 277::445    2e-44 40.4% 0041443 00414432 2/2   p containing nucleoside triphosphate hy 
 282::444  1.7e-43 31.8% 0051332 00513321 1/1   p containing nucleoside triphosphate hy 
  63::297    4e-43 36.5% 0050676 00506761 1/1   p containing nucleoside triphosphate hy 
 281::460  1.3e-42 37.5% 0038142 00381422 2/2   p containing nucleoside triphosphate hy 
 278::445  2.6e-42 40.0% 0040826 00408261 1/1   p containing nucleoside triphosphate hy 
  17::274  3.7e-42 34.5% 0052547 00525471 1/2   p containing nucleoside triphosphate hy 
 210::427  3.4e-41 32.2% 0051485 00514852 2/2   p containing nucleoside triphosphate hy 
 283::450  2.2e-39 35.3% 0043887 00438872 2/2   p containing nucleoside triphosphate hy 
 275::418  1.1e-38 46.3% 0039715 00397152 2/2   p containing nucleoside triphosphate hy 
 284::445    2e-38 32.7% 0037787 00377872 2/2   p containing nucleoside triphosphate hy 
 281::435  2.1e-38 36.6% 0038741 00387412 2/2   p containing nucleoside triphosphate hy 
  64::272    4e-37 39.6% 0035848 00358481 1/2   p containing nucleoside triphosphate hy 
  29::274  3.6e-36 30.8% 0038162 00381621 1/2   p containing nucleoside triphosphate hy 
  48::274  2.3e-33 35.8% 0052796 00527961 1/1   p containing nucleoside triphosphate hy 
  61::321    1e-32 24.3% 0051486 00514861 1/2   p containing nucleoside triphosphate hy 
 280::424  1.1e-32 39.3% 0042720 00427202 2/2   p containing nucleoside triphosphate hy 
 288::436  1.4e-30 38.9% 0042088 00420882 2/2   p containing nucleoside triphosphate hy 
  61::272  2.4e-28 34.8% 0036317 00363171 1/2   p containing nucleoside triphosphate hy 
 300::417  1.4e-27 42.5% 0042553 00425532 2/2   p containing nucleoside triphosphate hy 
  77::255  2.4e-27 43.2% 0051331 00513311 1/1   p containing nucleoside triphosphate hy 
 300::422  2.1e-26 41.1% 0043901 00439012 2/2   p containing nucleoside triphosphate hy 
 300::417  1.9e-25 46.2% 0044714 00447142 2/2   p containing nucleoside triphosphate hy 
 300::417  5.3e-23 44.2% 0038740 00387402 2/2   p containing nucleoside triphosphate hy 
  71::253  5.5e-21 30.1% 0051499 00514991 1/1   p containing nucleoside triphosphate hy 
  12::233    1e-19 45.5% 0034833 00348331 1/2   p containing nucleoside triphosphate hy 
  85::249  4.8e-16 34.6% 0043887 00438871 1/2   p containing nucleoside triphosphate hy 
  87::242  5.1e-16 38.0% 0038741 00387411 1/2   p containing nucleoside triphosphate hy 
  86::250    2e-15 36.7% 0037787 00377871 1/2   p containing nucleoside triphosphate hy 
  80::234  2.7e-13 37.9% 0041443 00414431 1/2   p containing nucleoside triphosphate hy 
  79::254  3.3e-13 30.8% 0034832 00348321 1/1   p containing nucleoside triphosphate hy 
 139::238  1.9e-12 46.7% 0036155 00361551 1/2   p containing nucleoside triphosphate hy 
 300::402    5e-12 28.0% 0038162 00381622 2/2   p containing nucleoside triphosphate hy 
  69::250  7.4e-12 24.5% 0050356 00503561 1/1   p containing nucleoside triphosphate hy 
 300::403  2.5e-11 30.0% 0052547 00525472 2/2   p containing nucleoside triphosphate hy 
 311::411  2.5e-11 24.2% 0038141 00381412 2/2   p containing nucleoside triphosphate hy 
 104::234  1.1e-09 24.1% 0039715 00397151 1/2   p containing nucleoside triphosphate hy 
 311::400  4.1e-09 31.1% 0035848 00358482 2/2   p containing nucleoside triphosphate hy 
 300::383  5.6e-08 31.2% 0049300 00493002 2/2   p containing nucleoside triphosphate hy 
 300::383  3.7e-06 33.8% 0053146 00531462 2/2   p containing nucleoside triphosphate hy 
  72::204  6.3e-06 28.1% 0049837 00498371 1/1   p containing nucleoside triphosphate hy 
 142::273  7.3e-06 26.6% 0038142 00381421 1/2   p containing nucleoside triphosphate hy 
 311::409  1.7e-05 24.7% 0038151 00381512 2/2   p containing nucleoside triphosphate hy 
 300::383  3.8e-05 32.1% 0052855 00528552 2/2   p containing nucleoside triphosphate hy 
 156::263  9.7e-05 20.4% 0037955 00379551 1/1   p containing nucleoside triphosphate hy 
  84::197  0.00027 32.1% 0042089 00420891 1/2   p containing nucleoside triphosphate hy 
  71::168  0.00083 32.5% 0050350 00503501 1/1   p containing nucleoside triphosphate hy 
 311::383   0.0023 30.8% 0043258 00432582 2/2   p containing nucleoside triphosphate hy 
  69::110    0.017 33.3% 0051485 00514851 1/2   p containing nucleoside triphosphate hy 
 323::367     0.87 15.9% 0051486 00514862 2/2   p containing nucleoside triphosphate hy 
 133::226     0.93 30.1% 0052549 00525491 1/2   p containing nucleoside triphosphate hy 
 300::383      7.4 25.0% 0050691 00506912 2/2   p containing nucleoside triphosphate hy 
 142::196      9.8 42.0% 0052823 00528231 1/2   p containing nucleoside triphosphate hy 
 311::367       11 33.3% 0036317 00363172 2/2   p containing nucleoside triphosphate hy 
 142::196       34 32.0% 0053147 00531471 1/2   p containing nucleoside triphosphate hy 
   1::634


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTQHDFRAEQPIASATDAFATPADAASPLDKLDAMLNADAAPAVEASENGFAKLGLDAAILRALAEANYN
00506771   1/1  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00506911   1/2  ----------------------------lllllellilvegllvptpllsfeelglspellealkklgfe
00531461   1/2  --------------------------------elllllvllsdlplpllsfedlglseellkalkklgfe
00425531   1/2  ------------------------------------------------ksfeelglseellkalkklgfl
00528551   1/2  -------------------------------------lvegldlplpllsfedlglspellealkklgfe
00493001   1/2  ------------------------------------------------lsfedlglseellkalkelgfe
00414421   1/1  --------------------------------------------------flllelsaellealkrllff
00439011   1/2  ------------------------------------------------ksfeelglseellkallelgfl
00447141   1/2  ----------------------------------------------pvlsfeelglseellkalkklgfl
00427201   1/2  ---------------------------------------llselllpvlsfedlglseellkalkklgfe
00514981   1/1  ----------------------------------------------------------------------
00527951   1/1  ----------------------------------------------------------------------
00387401   1/2  ---------------------------------------------epllsfeelglseellealkklgfl
00348332   2/2  ----------------------------------------------------------------------
00481111   1/1  -----------------------------eellaktlelklrlaegesldflllelsalllealkrllff
00525492   2/2  ----------------------------------------------------------------------
00420881   1/2  -----------------------------------------------llsfedlglseelldalkelfgf
00381511   1/2  --lllillelllalarllleellldllkldlilpees.............feelgldpellealkk.gff
00528232   2/2  ----------------------------------------------------------------------
00381411   1/2  -------------------------------------------------sfedlglpelllealkklgfe
00381631   1/1  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00493011   1/1  ----------------------------------------------------------------------
00432581   1/2  -------------------------------------------------mdillknlnelilveelkdel
00361552   2/2  ----------------------------------------------------------------------
00358491   1/1  ----------------------------------------------------------------------
00363181   1/1  ----------------------------------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00513321   1/1  ----------------------------------------------------------------------
00506761   1/1  --------------------------------------------------------------lllelgfl
00381422   2/2  ----------------------------------------------------------------------
00408261   1/1  ----------------------------------------------------------------------
00525471   1/2  ----------------deelldalkrllleellllalelllllalldllsfeelgldeellealkklgff
00514852   2/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00397152   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00358481   1/2  ---------------------------------------------------------------lkalgpf
00381621   1/2  ----------------------------leellllelellllellrllisfedlglleelleelkellpl
00527961   1/1  -----------------------------------------------Likkllkdllilllklgelllea
00514861   1/2  ------------------------------------------------------------ldgdlaelle
00427202   2/2  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00363171   1/2  ------------------------------------------------------------ikplklispf
00425532   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00348331   1/2  -----------llSATpp....................................................
00438871   1/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00361551   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00503561   1/1  --------------------------------------------------------------------kP
00525472   2/2  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00397151   1/2  ----------------------------------------------------------------------
00358482   2/2  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00379551   1/1  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00514851   1/2  --------------------------------------------------------------------Tk
00514862   2/2  ----------------------------------------------------------------------
00525491   1/2  ----------------------------------------------------------------------
00506912   2/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00363172   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TPTPVQAQAIPAFLAGRDLLVSSQTGSGKTAAFMLPAIQRISEKPATHRPTEPAKRMKGKRPRPSPAQPS
00506771   1/1  ------------------------------------------------------------------kgkr
00520041   1/1  ---------iipallsgrdvvllaaptGsGKTlaallpilellle.......................gg
00506911   1/2  kptpiQaeaipailegrdvlvvapTGsGKTlafllpilqlllklllllll............llklkgpr
00531461   1/2  kptpiQaeaipailegrdvlvqapTGsGKTlafllpilqlllklp.....................kgpr
00425531   1/2  kptpiQaeaipailegrdvlvqapTGsGKTlafllpileallkll.....................kggk
00528551   1/2  kptpiQaeaipailegrdvlvqapTGsGKTlafllpilqlllklp.....................kgpr
00493001   1/2  kptpiQaeaipailegrdvlvqapTGsGKTlafllpilllllkep.....................kgpr
00414421   1/1  rltpiQleaipallsgr..lleapTGsGKTlaallpallall........................ngkg
00439011   1/2  eltpiQleaiplilsgrdvllqapTGsGKTlafllpilqlllk.....................klkggq
00447141   1/2  eptpiQaeaipailegrdvlvvapTGsGKTlafllpllelllkep.....................kggk
00427201   1/2  eptpiQaeaipailegrdvlvqapTGsGKTlafllpllelllkllk.....................ggq
00514981   1/1  ----------------------------------------------------------------------
00527951   1/1  ----------------------------------------------------------------------
00387401   1/2  kptpiQleaipailegdrdvlvvapTGsGKTlaallpllelllkep......................gg
00348332   2/2  ----------------------------------------------------------------------
00481111   1/1  rptpiQllaipallegr..laqapTGsGKTlaallpallall........................agkq
00525492   2/2  ----------------------------------------------------------------------
00420881   1/2  teltpiQaeaipailegrdvlvvapTGsGKTlayllpall...........................rgg
00381511   1/2  eltpiQkeaipailkgrdlllvapTGsGKTlaallpalelllk........................gkr
00528232   2/2  ----------------------------------------------------------------------
00381411   1/2  .ltpiQkeaipailkgedvllvapTGsGKTlaallpaleallk........................gkr
00381631   1/1  ---------------grdvllaapTGsGKTlaallpilllll........................rgkr
00531472   2/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00493011   1/1  ----------------------------------------------------------------------
00432581   1/2  llelldlllfevkgdkpllllksgeldgelelalkelllpeglldallklleelgilvleedevlldell
00361552   2/2  ----------------------------------------------------------------------
00358491   1/1  --------------sgrdvlvvapTGsGKTlaallpallllla.......................lgkq
00363181   1/1  --------------egkdvllvapTGsGKTlvallpallrlle.......................kgkr
00414432   2/2  ----------------------------------------------------------------------
00513321   1/1  ----------------------------------------------------------------------
00506761   1/1  elrpyQleaipalleg.dvllaaptGsGKTlaallpilelllr.......................ggkr
00381422   2/2  ----------------------------------------------------------------------
00408261   1/1  ----------------------------------------------------------------------
00525471   1/2  elrpyQleaipallegresglpmdvllaaptGsGKTlvallailelll......................
00514852   2/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00397152   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00358481   1/2  eltpiQqeaipaileglesgprdvllvgptGtGKTltaaalalel.........................
00381621   1/2  kltpiQkeaipelleglesgkpknvllagptGsGKTlvallailelllr.....................
00527961   1/1  llellleellllallllellelleklllflllllpelleellkllgf.elrpyQleaieallegrdvlla
00514861   1/2  alldllieelerlllglllkrelldllrlpdlflllelpellpfelrpyQleavnwllervldlllgkgr
00427202   2/2  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00363171   1/2  eprpyQqeaiealleglekgkknvllvgptGtGKTltaaalaael.........................
00425532   2/2  ----------------------------------------------------------------------
00513311   1/1  ------elale...sgrdvllvaptGsGKTlaallpilelll.......................lrggr
00439012   2/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00514991   1/1  lellidlglpfelrpyQleaveallellekgrgglladptGsGKTlvalllilellergpak........
00348331   1/2  ................rpviaqavtgtgk..afklplllrllevl.....................kggq
00438871   1/2  --------------sgrdvlvvaptgsgktllfllpall...........................kggr
00387411   1/2  ----------------rdvlvqaptgsgktl.kllpllellle.......................kggr
00377871   1/2  ---------------grdvllvaptgsgKtla.llpllakl.........................kggr
00414431   1/2  ---------rpvtrkdipqlvyvt.gsgkklalllellellergq........................p
00348321   1/1  --------ilealrsgrvvllvgptGsGKTtlalalalel...........................ggr
00361551   1/2  --------------------------------------------------------------------gs
00381622   2/2  ----------------------------------------------------------------------
00503561   1/1  ydrLldivgigfltaddialalgiagdsperlllalallsellgeghlylplddlveellklleldelll
00525472   2/2  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00397151   1/2  ---------------------------------llesltleniaqlvllvdgslklllllllllllrggq
00358482   2/2  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00498371   1/1  -kLnpeQreairaa..ggpllvqGppGTGKTttlvariaylllegg....................lppk
00381421   1/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00379551   1/1  ----------------------------------------------------------------------
00420891   1/2  -------------ppdrlrqvlvvvgtgkklslllqllkll.........................kggq
00503501   1/1  ptlnpeQreairapl.kgpllvqGgaGtGKTttlvhriarlllngvpeslkekr................
00432582   2/2  ----------------------------------------------------------------------
00514851   1/2  kdvlkdLppkieivvyvelspeqkelyeallkgkdlllii------------------------------
00514862   2/2  ----------------------------------------------------------------------
00525491   1/2  --------------------------------------------------------------rPvdrlql
00506912   2/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00363172   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LLVLTPTRELALQVTEAAAKYGRHLRRIVCASILGGMPYPKQLAMLARMPDILVATPGRLLDHIEAGRID
00506771   1/1  alvlaPtreLalqiveelkkllpllglglrvallvggtslkerleilkkllsgadilvaTpgrlldlle.
00520041   1/1  grvlvlaPtralaeqvaeelr............gltggervrllerllsgeadilvgtpgrlldlllrd.
00506911   1/2  alilaPtreLalqiaeelkkllkll.glrvalltggtsldeqiralkkgpdilvaTpgrlldllrrgkld
00531461   1/2  alvlaPtrelalqiaeelkkllkllg.irvalltgglsikerlralkggadilvaTpgrlldlllrglld
00425531   1/2  alvfaptrelaeqlaeelrklgkelglllgikvallhgglsqkerlralkgkadilvaTpgrllddlaar
00528551   1/2  alvlaPtrelalqiaeelkkllkll.glrvalltgglslkerleallrggadilvaTpgrlldllrrgll
00493001   1/2  alvlaptrelalqiaevlrkllkllg.lrvalltgglslkerlralkggadilvaTpgrlldlllrrgld
00414421   1/1  vlvitPtreLaeqiaeelrellkflg.lkvglltgglslkerr..laggadilvgTpgrllddllrdnla
00439011   1/2  vlifvptrelaeqlaevlrellkflpglkvallhgglsqkerleafkkgkvdilvaTpgrllddllargl
00447141   1/2  alvfvptrelaeqlaevlrkllklllgikvallhgglsqeerlrvlkgkvdilvaTpgrllddlaargld
00427201   1/2  alvfvptrelaeqlaeelrkllkll.gikvallhgglsqkerleil.gkvdilvaTpgrllddlaargld
00514981   1/1  ---------------------------------------------------------------------k
00527951   1/1  ----------------------------------------------------------------------
00387401   1/2  kvlvfvptrelaeqlaerlkkllkll.glkvgllhgglsqkerlral.gkadilvaTpgrllddlaargl
00348332   2/2  ----------------------------------------------------------------------
00481111   1/1  vlvvtptreLaeqvaevlkklleflg.lsvglltgglslkerr..laggadivvgTpgrllddylrdnhl
00525492   2/2  ----------------------------------------------------------------------
00420881   1/2  kvlvfvptrelaeqlaeelrkl.....girvallhgglsqeerervleafrsgkadilvaTpgrllddll
00381511   1/2  vlvlaPtrelaeqiaeelrkllgflgldlelkvallhgglslkereealedlgeadilvaTpgrlldllr
00528232   2/2  ----------------------------------------------------------------------
00381411   1/2  vlvlaptrelaeqiaeelrkllgelggdlklkvallhgglslkereealerfgeadilvaTpgrlldgld
00381631   1/1  vlvlaPtreLaeqiaeelkkllg...............................................
00531472   2/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00493011   1/1  ----------------------------------------------------------------------
00432581   1/2  sfedlgldeelleallkfgffelrpyQkeaieallegknvllvapTGsGKTlvallailellern.....
00361552   2/2  ----------------------------------------------------------------------
00358491   1/1  vlvlvPtr..............................................................
00363181   1/1  vlvlvptrelalqlaeelkkl.................................................
00414432   2/2  ----------------------------------------------------------------------
00513321   1/1  ----------------------------------------------------------------------
00506761   1/1  vlvlvPtrelaeqwaeelrkllg.llglkvglltgglslkerleal.ggadilvttpgrlldlllrdlll
00381422   2/2  ----------------------------------------------------------------------
00408261   1/1  ----------------------------------------------------------------------
00525471   1/2  ..rgkrvlvlvPtrelaeqwaeelkkllpel.glkvallhgglsqkereealekfksgeadilvaTpgrl
00514852   2/2  ---------------------------------------------------------------------T
00438872   2/2  ----------------------------------------------------------------------
00397152   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00358481   1/2  ..gkqvlvlaptrelaeqlaeelrelfpelpvilfldeidalpperlspssdviirvallhgglseaerl
00381621   1/2  ...gkqvlvlvPtralaeqlaeefkklfgll.glrvgllhgglskkereeileklrsgeadilvgTpell
00527961   1/1  gptGsGKTlvalllilel...........................gkrvlvlaPtraLaeqwaeel.kf.
00514861   1/2  gglladetGsGKTlvalllilelllrgklkgpl.................akrvlvvvPt.sLaeqwlee
00427202   2/2  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00363171   1/2  ..gkpvlivaptkeladqlyeelkkllp...elkvellhggldylqkealfpeidtlpykdaspneeidl
00425532   2/2  ----------------------------------------------------------------------
00513311   1/1  vlvlaPtrelalqvaeelr.......glkvglltgglslkerletl.....ilvatpgrlldlllrd.ll
00439012   2/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00514991   1/1  ..............rvlvvvP.rslaeqwaeelkkfl...pglkvgvltgglkl.....lllgkadivit
00348331   1/2  alvfcptreladqlaeeLrk.....rglkvlalhggls...qrrflkgkvdvlVATdvaerGiDpdvdlV
00438871   1/2  vlvltptrelaeqlaevlrkl.....gikvavlhgglsqeereeileafrngeidvLvaT.....dvlgr
00387411   1/2  vlvfvptrelaeqlaellrkl.....gikvavlhgglsqeereevleafrsgkidvLvaT.....dvlgr
00377871   1/2  vlvlaptrelaeqlaellke.....lgikvavlhgglsqeereeilerfrsgeikvlvaTdvlerGlDip
00414431   1/2  vLvftptrelaeqlaelLrkl.....gikalvlhgglsqeereivleafrkg.dvlvATdvagrGlDivL
00348321   1/1  vlvlvptralaeqlaerlakl....lglrvgllvgylirfes.......trilvvtyglllrll...dll
00361551   1/2  alvFcptreeaeqlaeeLrel.....glkalalhGgls...qrrflngkvdvlVATdvaerGiDpdvdfV
00381622   2/2  ----------------------------------------------------------------------
00503561   1/1  elieleellkelleeilvellkedlelvlderrlyleeleldelglaellkelleeleideklldkildd
00525472   2/2  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00397151   1/2  alvfvptrelaeqlaellrkl.....gikvlalhgglsqee...flsggvdvlvAT.....dvaerG.ld
00358482   2/2  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00498371   1/1  rilvvtftnaaadelrerllkllgel......................gldgvevstfhslalr------
00381421   1/2  -lifvptrklaeelaelL...........vavlhgglsqeeReeilekfrngeidvLvaTasll.dvlar
00381512   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00379551   1/1  ---------------karlqkrkavldarlaaaleerglvlvftgnGkGkttaalglalralghglrvlv
00420891   1/2  vlvfvptrelaeqlaelLrel.....gikvaalhgglsqeereevlerfrsgeidvL-------------
00503501   1/1  ....vpperiLvvtfTnkAadelrerlr------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00514851   1/2  ----------------------------------------------------------------------
00514862   2/2  ----------------------------------------------------------------------
00525491   1/2  vivvgsgkklvlllallkelekggqvlvfvptrklaeqlaelLrellpgir.....vallhgdlsqeere
00506912   2/2  ----------------------------------------------------------------------
00528231   1/2  -lvfvptrelaeqlaelLrel.....gikvallhgglsqeeReeilerfrsgeidv--------------
00363172   2/2  ----------------------------------------------------------------------
00531471   1/2  -lvfcntrklaellaelLrel.....gikvavlhgglsqkereeiledfrsgeidv--------------


                         -         -         -         +         -         -         -:280
query           LSALEMLVFDEADRMLDMGFADDIDAIVAATPASRQTLMFSATLDARIAQLASRQLRDPQRIEIAAARAD
00506771   1/1  ....lsnldllviDEaHrlldmgfrkllrrl.....pdrqvlllsATpipnvlelllsllgllvp.....
00520041   1/1  lllrnldlviiDEahrl.dlgfgpllrlllellprpdlqllllSATpppe....................
00506911   1/2  lsnlkllvlDEadrlldmgfgpdlelilsrlprllgkdrqtllfSATlpneveelaklllrdpvl-----
00531461   1/2  lsnlklvvlDEadrlldmgfgpdlrlilrrlppdrqtllfSATlpnevlelaklllrdpvlilvgd----
00425531   1/2  gldlpnvdlvilDeahrigrtgrggdlglillllppdrqtlllSATlpnevlelaklllldpvli-----
00528551   1/2  dlsnlkllvlDEadrlldmgfgpdlrkilrrlpkdrqtlllSATlpnevlelaklllldpvlilvg----
00493001   1/2  lsnlkllvlDEadrlldlgfgpdlrlilrrlpkdrqtlllSATlpnevlelallllrdpvlilvgp----
00414421   1/1  lslgllvlrnldllviDEahrllvdegfrplilsi...................................
00439011   1/2  dlpnvdlvildeahrigrtgrfgrkglaillllpkerqtlllSATlpeellelakkllrdpvli------
00447141   1/2  lpdvdlvvlDeahrigrtgragdlgkillllppdrqtlllSATlpnevlelaklllrnpvlie-------
00427201   1/2  lpnvdlvilDEadrllnydfplslesylqrlgrtgrtlllSATagneglalllvllkdpvllk-------
00514981   1/1  lsnwdllvlDEahrllnmgfrsqirkilkllpkarqrllltaTpiq.....lllllldpvli........
00527951   1/1  lsnlgllvlDEahrlld.gfgpqlrkilellpkarqvlllsATpirevlllallllldpvvievl.....
00387401   1/2  dlpnvdlvilDeahrlgrtgrggllgkillllppdlqvlllSATlppnvlelaklllndpviiivg----
00348332   2/2  --------------------------------------llSATpp.........................
00481111   1/1  lrqedlvlrnlsllviDEaDrllddgfrtlliiilkllktlasitlqnlfrldrqlllfsATltp-----
00525492   2/2  ----------------------------------------------------------------------
00420881   1/2  argldlpdvdlvilDEahrlldlgksfepyvqrigragragkdgqalllsATltpevlellrlllk----
00381511   1/2  d....lknldlvilDEahrlldeqrgpllelllmgflsqlreilralpadvqvlllSATppprvlel---
00528232   2/2  --------------------------------------------------------------------ll
00381411   1/2  r....lknldlviiDEahrlldsqrgpllellllgflsqlreilralppdvqvlllSATpppnvlel---
00381631   1/1  ......................................................................
00531472   2/2  ------------------------------------------------------------------eslt
00420892   2/2  ---------------------------------------------------------------------p
00493011   1/1  -------------------------------------------------------------------slt
00432581   1/2  ..................gkkvlvlvPtraLaeqiaeelkklfgil.glkvavltgglskke--------
00361552   2/2  --------------------------------------llSATfpr........................
00358491   1/1  ......................................................................
00363181   1/1  ......................................................................
00414432   2/2  ------------------------------------------------------------------rpvt
00513321   1/1  ----------------------------------------------------------------------
00506761   1/1  lsnldlvilDEaHrlldlgfgplllkilrrlrpdlrvlllsATpiqnvlelas.llglpvpiilgrlapv
00381422   2/2  ----------------------------------------------------------------------
00408261   1/1  -------------------------------------------------------------------ipl
00525471   1/2  l.....rgldlpnldlviiDEahrl...gfrd.laqllgrlpr.aqvlllSATPipntlaellf------
00514852   2/2  kkdvlkdLppkieivvyvelspeqkelyeallkgkdllliiideagktlvlnlllllrkicnhpvLllek
00438872   2/2  ----------------------------------------------------------------------
00397152   2/2  ----------------------------------------------------------------lleslt
00377872   2/2  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00358481   1/2  ealrallegeadilvaTvgrlldlldpallrlgrldllvgdeadldellktllelGydrvdl--------
00381621   1/2  fdllr.....lknlglviiDEahrlgvkqr.....eillslldnvqvlllsATpipntldlals------
00527961   1/1  ..lg.lklvglltgglslke.........divitTpgrlldlld...lllknldlviiDEaHrl------
00514861   1/2  fkkffpgl..lkvlvltgglsakerkelleklasgepllkadivittyqlllkdlef..lslrnldlvii
00427202   2/2  ---------------------------------------------------------------------l
00420882   2/2  ----------------------------------------------------------------------
00363171   1/2  erlsallallegepdivvatvqalldlpkpellllltltllvgdeldldellerLvelgYer--------
00425532   2/2  ----------------------------------------------------------------------
00513311   1/1  lsnldllvlDEah.lldlgfrlllelllellplpdlqllllsATp-------------------------
00439012   2/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00514991   1/1  tyelllrllelknl...kfdlviiDEaHrlknrg..sklreal---------------------------
00348331   1/2  idydlvkvpvldvdtgptlllll-----------------------------------------------
00438871   1/2  G.ldipdvdlVinydlpkspesyiQriGRagRagqkgla-------------------------------
00387411   1/2  G.idlpdvdlViiydlpkspesyiQriGRagR--------------------------------------
00377871   1/2  dvdlViiydlpkslasyiQriGR......agRagqkglvi------------------------------
00414431   1/2  gpgvdlvinydlpkspesyvhril----------------------------------------------
00348321   1/1  lsdfdliiiDEahelsaetdlllglllelle.....lrpdlkvl--------------------------
00361551   1/2  idydlvkvpvldpdtrptlvislvvvpi------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00503561   1/1  legilplnpeQkeaieailkgrvvliqGppGtGKTtl.al------------------------------
00525472   2/2  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00397151   1/2  .pdvdlVinydldlllplslesyv----------------------------------------------
00358482   2/2  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00381421   1/2  G.lDipdrvdlVinydapkflvklkellkllgllldlllllatliddllrllllllevie...-------
00381512   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00379551   1/1  vqflkggwdtgelaalkrlgvdvvvlgegftwdtedreldlaaarealelake-----------------
00420891   1/2  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00514851   1/2  ----------------------------------------------------------------------
00514862   2/2  ----------------------------------------------------------------------
00525491   1/2  evleafrngeidvLva------------------------------------------------------
00506912   2/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00363172   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           HSNIEQRLHFTDDMSHKERLLDHLLRDASLKQAIVFTATKRDADSLAERLSDTGFSAGALHGDMTQGARN
00506771   1/1  .....dllkqfvlvvlke.ekleallellkellalgrggkvlvfvntrktaellaelLrelgikvaalhg
00520041   1/1  eltlpllrldv.llveeslklelllellelllelggkvlvfvnsreeaellaellrelgikvlvlhggls
00506911   1/2  ----------------------------------------------------------------------
00531461   1/2  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00528551   1/2  ----------------------------------------------------------------------
00493001   1/2  ----------------------------------------------------------------------
00414421   1/1  ......................................................................
00439011   1/2  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00514981   1/1  .....dqllllveesgKleallellkellekgekvliFsqtkdtldllaelLrkllgikvarlhgdlsqk
00527951   1/1  pelikqvvlvvps.sgkleallellkelkgkqvlvfvntrelaeqlaell.....gvallhgdlsqkere
00387401   1/2  ----------------------------------------------------------------------
00348332   2/2  rpviaqavtgtgk.afklplllrllevlkggqalvfcptreladqlaeeLrkrglkvlalhgglsqrr..
00481111   1/1  ----------------------------------------------------------------------
00525492   2/2  -rPvdrlqlvivvgs.gkklvlllallkelekggqvlvfvptrklaeqlaelLrellpgirvallhgdls
00420881   1/2  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00528232   2/2  ppgllqqllvvvtesgkleallellkelkggqvlvfvptrelaeqlaelLrelgikvallhgglsqeeRe
00381411   1/2  ----------------------------------------------------------------------
00381631   1/1  ..........................................aeelaellk..gikvallhgglsqeere
00531472   2/2  penllqivlvvveesgklelllellkelrggkvlvfcntrklaellaelLrelgikvavlhgglsqkere
00420892   2/2  pdrlrqvlvvvgt.gkklslllqllkllkggqvlvfvptrelaeqlaelLrelgikvaalhgglsqeere
00493011   1/1  ppnlkqivivvee.sdklelllellkelrggkvlvfcntrktaeelaelLrelgikvaalhgglsqeeRe
00432581   1/2  ----------------------------------------------------------------------
00361552   2/2  .pnieqevlpvde.evkldlllrllevlrggsalvFcptreeaeqlaeeLrelglkalalhGglsqrr..
00358491   1/1  ........................................ktaeelaellrelgikvaalhgdlsqeere
00363181   1/1  .....................................................gikvavlhgdlsqkere
00414432   2/2  rkdipqlvyvt.gsgkklalllellellergqpvLvftptrelaeqlaelLrklgikalvlhgglsqeer
00513321   1/1  -Grlspvetlyrpilsvevvvleekleallellkelg.gsvlvFvnsrkeveelaelLrklgikvavlhG
00506761   1/1  dglilqvv........r-----------------------------------------------------
00381422   2/2  rpnltqlviyvgseekleallsll.....gkkvlifvptrklaeelaelL......vavlhgglsqeeRe
00408261   1/1  vrlikqdvlvvt.eegklkallellkellaegeqvlvftptielaellaelLkelgipaavlhgdlsqee
00525471   1/2  ----------------------------------------------------------------------
00514852   2/2  llsasqgfedflpdilqllpl............................................llllv
00438872   2/2  --sgrdvlvvaptgsgktllfllpall.kggrvlvltptrelaeqlaevlrklgikvavlhgglsqeere
00397152   2/2  leniaqlvllvdg.slklllllllllllrggqalvfvptrelaeqlaellrklgikvlalhgglsqee..
00377872   2/2  ---grdvllvaptgsgKtlallpllaklkggrvlvlaptrelaeqlaellkelgikvavlhgglsqeere
00387412   2/2  rdvlvqaptgsgktlkllpllellle..kggrvlvfvptrelaeqlaellrklgikvavlhgglsqeere
00358481   1/2  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514861   1/2  DEaHr.lk.nfgsklrkalkrl.kaarrlllTATPiqnnle-----------------------------
00427202   2/2  lselllpvlsfedlglseellkalkklgfeeptpiQaeaipailegrdvlvqapTGsGKTlafllpllel
00420882   2/2  -------llsfedlglseelldalkelfgfteltpiQaeaipailegrdvlvvapTGsGKTlayllpall
00363171   1/2  ----------------------------------------------------------------------
00425532   2/2  -------------------ileallkllkggkalvfaptrelaeqlaeelrklgkelglllgikvallhg
00513311   1/1  ----------------------------------------------------------------------
00439012   2/2  -------------------ilqlllkklkggqvlifvptrelaeqlaevlrellkflpglkvallhggls
00447142   2/2  -------------------pvlsfeelglseellkalkklgfleptpiQaeaipailegrdvlvvapTGs
00387402   2/2  -------------------llelllkep.ggkvlvfvptrelaeqlaerlkkllkllglkvgllhgglsq
00514991   1/1  ----------------------------------------------------------------------
00348331   1/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00361551   1/2  ----------------------------------------------------------------------
00381622   2/2  -------------------ilelllrg...kqvlvlvPtralaeqlaeefkklfgllglrvgllhgglsk
00503561   1/1  ----------------------------------------------------------------------
00525472   2/2  -------------------ilelllrgk...rvlvlvPtrelaeqwaeelkkllpelglkvallhgglsq
00381412   2/2  ------------------------------krvlvlaptrelaeqiaeelrkllgelggdlklkvallhg
00397151   1/2  ----------------------------------------------------------------------
00358482   2/2  ------------------------------kqvlvlaptrelaeqlaeelrelfpelpvilfldeidalp
00493002   2/2  -------------------illlllkepkgpralvlaptrelalqiaevlrkllkllglrvalltgglsl
00531462   2/2  -------------------ilqlllklpkgpralvlaPtrelalqiaeelkkllkllgirvalltgglsi
00498371   1/1  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00381512   2/2  ------------------------------krvlvlaPtrelaeqiaeelrkllgflgldlelkvallhg
00528552   2/2  -------------------ilqlllklpkgpralvlaPtrelalqiaeelkkllkllglrvalltgglsl
00379551   1/1  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00432582   2/2  ------------------------------kkvlvlvPtraLaeqiaeelkklfgilglkvavltgglsk
00514851   1/2  ----------------------------------------------------------------------
00514862   2/2  ------------------------------------------leefkkffpgl.lkvlvltgglsakerk
00525491   1/2  ----------------------------------------------------------------------
00506912   2/2  -------------------ilqlllklllllllllklkgpralilaPtreLalqiaeelkkllkllglrv
00528231   1/2  ----------------------------------------------------------------------
00363172   2/2  ------------------------------kpvlivaptkeladqlyeelkkllpelkvellhggldylq
00531471   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RTLTALRRGNLRVLVATDVAARGIDVPDITHVVNFDLPKQAEDYVHRIGRTGRAGRSGVAINLVNHGDMF
00506771   1/1  llssssllglsqeereeiledfrngeidvLvatdvlerGlDipdvdlvinydlpkslasyiQriGRagRa
00520041   1/1  qeereevle....geikvlvatdvlerGlDi.dvdlViiydlvkldvllldldlglvllllrplslasyi
00506911   1/2  ----------------------------------------------------------------------
00531461   1/2  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00528551   1/2  ----------------------------------------------------------------------
00493001   1/2  ----------------------------------------------------------------------
00414421   1/1  ....................................vdtvinydlpnsledylqriGRtgRagtegeail
00439011   1/2  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00514981   1/1  eReeildrfrngedviviLvstdaagrGlnltganhVinydlpwnpavyvQrigRagRiGqkgdvtvyrl
00527951   1/1  eiledfrngeidvLvatdvlerGiDipdvdlvinldlpkslesyvQriGRagRagkkglaillvdpddle
00387401   1/2  ----------------------------------------------------------------------
00348332   2/2  .....flkgkvdvlVATdvaerGiD.pdvdlVidydlvkvpvldvdtgptlllllvtlpislesyvQRiG
00481111   1/1  ----------------------------------------------------------------------
00525492   2/2  qeereevleafrngeidvLvaTdvaarGldipdvdlViiydlprslesylhQraGRagRagkkglaillv
00420881   1/2  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00528232   2/2  eilerfrsgeidvLvaTdvaarGlDipnvdlVinydlprnpalelslesyvqriGRagRagkkglaillv
00381411   1/2  ----------------------------------------------------------------------
00381631   1/1  evleafrsgeidvLvaTdvlerGlDipdvdlViiydlpkslesylQrirGRagRagrdglaillvspedl
00531472   2/2  eiledfrsgeidvLvaTdvlarGlDipdvdlVinydlpkslelyiQriGRagRagqkgeaillvlpedlt
00420892   2/2  evlerfrsgeidvLvaTdvlarGiDipnvdlVinydlpkspedyiQriGRagRagqkglaillvtpedlt
00493011   1/1  eiledfrngeidvLvaTdvlarGiDipdvdlVinydlpkslesyvQriGRagRagqkglaillvtpedls
00432581   1/2  ----------------------------------------------------------------------
00361552   2/2  .....flngkvdvlVATdvaerGiD.pdvdfVidydlvkvpvldpdtrptlvislvvvpislesyiQRiG
00358491   1/1  eiledfrngeidvLvatdvlarGlDipdvdlvinldlpkllllqslelyiQriGRagRagkkglaillvl
00363181   1/1  eiledfrngeidvLvatdvlarGlDipnvdlViildlpklllllslelyiQriGRagRagkkglaillvt
00414432   2/2  eivleafrkg..dvlvATdvagrGlDivLgpgvdlvinydlpkspesyvhrildllrigqlklvlvkllv
00513321   1/1  g....erekvlelfkngkikvlvATdvaerGiDi.dvdlVidyglplkvkvfdgrtgverletrpislas
00506761   1/1  ----------------------------------------------------------------------
00381422   2/2  eilekfrngeidvLvaTaslldvlarGlDipdrvdlVinydapkflvklkellkllgllldlllllatli
00408261   1/1  reivleafrsg..dvlvaTdvagrGlDipnvsvvlelGgllVinydlpksleiyvQriGRagRagdkgla
00525471   1/2  ----------------------------------------------------------------------
00514852   2/2  eesgKleallellkelliergekvlvFsntretlellaelLrelgikvarlhGglsqeeReeiierFrdp
00438872   2/2  eileafrngeidvLvaTdvlgrGldipdvdlVinydlpkspesyiQriGRagRagqkglailllspedll
00397152   2/2  .....flsggvdvlvATdvaerGld.pdvdlVinydldlllplslesyvqriGRtGR.gkpglaillv--
00377872   2/2  eilerfrsgeikvlvaTdvlerGlDipdvdlViiydlpkslasyiQriGRagRagqkglvillldeadll
00387412   2/2  evleafrsgkidvLvaTdvlgrGidlpdvdlViiydlpkspesyiQriGRagRagqkglaillldeadrt
00358481   1/2  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514861   1/2  ----------------------------------------------------------------------
00427202   2/2  llkllkggqalvfvptrelaeqlaeelrkllkllgikvallhgglsqkerleil.....gkvdilvaTpg
00420882   2/2  rggkvlvfvptrelaeqlaeelrklgirvallhgglsqeerervleafrsgkadilvaTpgrllddllar
00363171   1/2  ----------------------------------------------------------------------
00425532   2/2  glsqkerlralk....gkadilvaTpgrllddlaargldlpnvdlvil........Deahrigrtgr---
00513311   1/1  ----------------------------------------------------------------------
00439012   2/2  qker...leafkkgkvdilvaTpgrllddllargldlpnvdlvil........deahrigrtgrfgrkgl
00447142   2/2  GKTlafllpllelllkepkggkalvfvptrelaeqlaevlrkllklllgikvallhgglsqeerlrv---
00387402   2/2  kerlral.....gkadilvaTpgrllddlaargldlpnvdlvil........Deahrlgrtgrggll---
00514991   1/1  ----------------------------------------------------------------------
00348331   1/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00361551   1/2  ----------------------------------------------------------------------
00381622   2/2  kereeileklrsgeadilvgTpellfdllrlknlglviiDEahrlgvkqrei------------------
00503561   1/1  ----------------------------------------------------------------------
00525472   2/2  kereealekfksgeadilvaTpgrllrgldlpnldlviiDEahrlgfrd.laq-----------------
00381412   2/2  glslkereealerf..geadilvaTpgrlldgldrlknldlviiDEahrlldsqrgpllel---------
00397151   1/2  ----------------------------------------------------------------------
00358482   2/2  perlspssdviirvallhgglseaerlealrallegeadilvaTvgrlld--------------------
00493002   2/2  kerlralk....ggadilvaTpgrlldlllrrg-------------------------------------
00531462   2/2  kerlralk....ggadilvaTpgrlldlllrgl-------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00381512   2/2  glslkereealedl..geadilvaTpgrlldllrdlknldlvilDEahrlldeqrgpll-----------
00528552   2/2  kerleall...rggadilvaTpgrlldllrrgl-------------------------------------
00379551   1/1  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00432582   2/2  ker.......lrgdadivvaTperldsllrrl.-------------------------------------
00514851   1/2  ----------------------------------------------------------------------
00514862   2/2  elleklasgepllkadi-----------------------------------------------------
00525491   1/2  ----------------------------------------------------------------------
00506912   2/2  alltggtsldeqiralkk....gpdilvaTpgr-------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00363172   2/2  kealfpeidtlpykdas-----------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           QWRRIERFTNNRIDASVIEGFEPRRSPKPRSNFGGKPGGRDGFRGNGGTGGGYRGNNGSGGYRGNREGSG
00506771   1/1  gk.glvil--------------------------------------------------------------
00520041   1/1  Qr--------------------------------------------------------------------
00506911   1/2  ----------------------------------------------------------------------
00531461   1/2  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00528551   1/2  ----------------------------------------------------------------------
00493001   1/2  ----------------------------------------------------------------------
00414421   1/1  lltpl-----------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00514981   1/1  vtegtieeki------------------------------------------------------------
00527951   1/1  ll--------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00348332   2/2  RaGR.gkpGvaillyspedllllr----------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00525492   2/2  tpddllllralerleilrealdllpgfllalldleirglg------------------------------
00420881   1/2  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00528232   2/2  tpddlelllallellklgl---------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00381631   1/1  kllkaleellelllelllleldllllla------------------------------------------
00531472   2/2  lleaieellgfklalldlelrglg----------------------------------------------
00420892   2/2  llekllellleklsllelaledlllrgilellgcrragllsylgedfrpdylrldlclgd----------
00493011   1/1  llealeellgfklalldlelrgl-----------------------------------------------
00432581   1/2  ----------------------------------------------------------------------
00361552   2/2  RaGR.ggkgsayrlvtpeedlllirie-------------------------------------------
00358491   1/1  lddllllallelllrralellglel---------------------------------------------
00363181   1/1  ledllllrallellkralellvllllglilaelll-----------------------------------
00414432   2/2  ldeadevldlGglhvigterhesrr---------------------------------------------
00513321   1/1  yiQraGRaGRagkpvGtailly..----------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00381422   2/2  ddllrllllllevieeirellkellldeevlekllnlpdf------------------------------
00408261   1/1  ilfvsledllllrfilellklkldl---------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00514852   2/2  dgeirvf---------------------------------------------------------------
00438872   2/2  llralielllgkklalldlelrgigellgt----------------------------------------
00397152   2/2  ----------------------------------------------------------------------
00377872   2/2  lleallellrrklelldlelrglge---------------------------------------------
00387412   2/2  llekllellekklel-------------------------------------------------------
00358481   1/2  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514861   1/2  ----------------------------------------------------------------------
00427202   2/2  rlld------------------------------------------------------------------
00420882   2/2  gldlpdvdlvilDEah------------------------------------------------------
00363171   1/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00439012   2/2  ai--------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00348331   1/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00361551   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00397151   1/2  ----------------------------------------------------------------------
00358482   2/2  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00379551   1/1  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00514851   1/2  ----------------------------------------------------------------------
00514862   2/2  ----------------------------------------------------------------------
00525491   1/2  ----------------------------------------------------------------------
00506912   2/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00363172   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           DRNFGERRFSSDNRGFGDRAPRPFGDDNRGGFGDRGERGFGDRSNGNSNGGYRGQGQGQGQGQAQQRSFG
00506771   1/1  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00506911   1/2  ----------------------------------------------------------------------
00531461   1/2  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00528551   1/2  ----------------------------------------------------------------------
00493001   1/2  ----------------------------------------------------------------------
00414421   1/1  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00514981   1/1  ----------------------------------------------------------------------
00527951   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00348332   2/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00525492   2/2  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00381631   1/1  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00493011   1/1  ----------------------------------------------------------------------
00432581   1/2  ----------------------------------------------------------------------
00361552   2/2  ----------------------------------------------------------------------
00358491   1/1  ----------------------------------------------------------------------
00363181   1/1  ----------------------------------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00513321   1/1  ----------------------------------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00381422   2/2  ----------------------------------------------------------------------
00408261   1/1  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00514852   2/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00397152   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00358481   1/2  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514861   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00363171   1/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00348331   1/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00361551   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00397151   1/2  ----------------------------------------------------------------------
00358482   2/2  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00379551   1/1  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00514851   1/2  ----------------------------------------------------------------------
00514862   2/2  ----------------------------------------------------------------------
00525491   1/2  ----------------------------------------------------------------------
00506912   2/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00363172   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           GERSFGNRDFAQRDGNRDATQRDGNRSFGGNRDGQRDGNRSFGDRSFGDRKFGDRGGDRGGFGGQRNSRS
00506771   1/1  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00506911   1/2  ----------------------------------------------------------------------
00531461   1/2  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00528551   1/2  ----------------------------------------------------------------------
00493001   1/2  ----------------------------------------------------------------------
00414421   1/1  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00514981   1/1  ----------------------------------------------------------------------
00527951   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00348332   2/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00525492   2/2  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00381631   1/1  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00493011   1/1  ----------------------------------------------------------------------
00432581   1/2  ----------------------------------------------------------------------
00361552   2/2  ----------------------------------------------------------------------
00358491   1/1  ----------------------------------------------------------------------
00363181   1/1  ----------------------------------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00513321   1/1  ----------------------------------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00381422   2/2  ----------------------------------------------------------------------
00408261   1/1  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00514852   2/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00397152   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00358481   1/2  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514861   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00363171   1/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00348331   1/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00361551   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00397151   1/2  ----------------------------------------------------------------------
00358482   2/2  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00379551   1/1  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00514851   1/2  ----------------------------------------------------------------------
00514862   2/2  ----------------------------------------------------------------------
00525491   1/2  ----------------------------------------------------------------------
00506912   2/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00363172   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           RYER------------------------------------------------------------------
00506771   1/1  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00506911   1/2  ----------------------------------------------------------------------
00531461   1/2  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00528551   1/2  ----------------------------------------------------------------------
00493001   1/2  ----------------------------------------------------------------------
00414421   1/1  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00514981   1/1  ----------------------------------------------------------------------
00527951   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00348332   2/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00525492   2/2  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00381631   1/1  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00493011   1/1  ----------------------------------------------------------------------
00432581   1/2  ----------------------------------------------------------------------
00361552   2/2  ----------------------------------------------------------------------
00358491   1/1  ----------------------------------------------------------------------
00363181   1/1  ----------------------------------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00513321   1/1  ----------------------------------------------------------------------
00506761   1/1  ----------------------------------------------------------------------
00381422   2/2  ----------------------------------------------------------------------
00408261   1/1  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00514852   2/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00397152   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00358481   1/2  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514861   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00363171   1/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00348331   1/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00361551   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00397151   1/2  ----------------------------------------------------------------------
00358482   2/2  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00379551   1/1  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00503501   1/1  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00514851   1/2  ----------------------------------------------------------------------
00514862   2/2  ----------------------------------------------------------------------
00525491   1/2  ----------------------------------------------------------------------
00506912   2/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00363172   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------