[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF09446.1


[Show Plain Result]

## Summary of Sequence Search
   1::166
   2::162  1.7e-68 55.3% 0053343 00533431 1/1   rofolate reductase-like                 
   1::160  7.5e-66 53.8% 0047835 00478351 1/1   rofolate reductase-like                 
   1::160    9e-61 49.1% 0039349 00393491 1/1   rofolate reductase-like                 
   1::161  2.1e-56 48.1% 0049139 00491391 1/1   rofolate reductase-like                 
   1::160  2.2e-56 52.5% 0035127 00351271 1/1   rofolate reductase-like                 
   1::163    3e-54 45.7% 0047688 00476881 1/1   rofolate reductase-like                 
   1::160  3.5e-54 51.3% 0043051 00430511 1/1   rofolate reductase-like                 
   3::161    1e-52 49.0% 0044710 00447101 1/1   rofolate reductase-like                 
   4::162    2e-51 47.2% 0053318 00533181 1/1   rofolate reductase-like                 
   3::161  4.2e-50 47.7% 0046319 00463191 1/1   rofolate reductase-like                 
   4::162    1e-43 44.7% 0053378 00533781 1/1   rofolate reductase-like                 
   2::158  4.3e-41 42.3% 0036228 00362281 1/1   rofolate reductase-like                 
   2::160  2.2e-30 28.9% 0053054 00530541 1/1   rofolate reductase-like                 
   1::166


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTLLTLIVARARNGVIGRNNTLPWRLPEDLQHFKRTTMGAPIIMGRKTWDSIGRPLPGRRNIVVTRNRDL
00533431   1/1  -mkislivAvslngvIGkdgdlPWhlpedlkhFkelTlgkpytsflgkinvvimGRkTyeslplkfrplp
00478351   1/1  lmklslivAvdlngvIGkdgdLPWhllpeDlkyFkelTlglsflgkinavimGrkTyeslpekfrplpgr
00393491   1/1  MlssvlvlldipllnlrlkllklllpkislivAvslngvIGkdgdlpWlllpedlkyFkklTtlvsdsgk
00491391   1/1  k..iilivavsldgvigkdgdlpwllpedlkhfkeltagdavimGrkTyesiprplpgrpniVlsrsldl
00351271   1/1  MlslpkislivAvsldgvIGkdgdlpwllpedlkhfkeltlglellskidavimGrkTfeslplklrplp
00476881   1/1  MiklivalivavsldGvenlgIGkdgdlpwlhlpedlkyfkaltlgdavimGrkTyeslprplpgrpniV
00430511   1/1  mmpkiilivAvsldgvIGkdgdlpwhlpedlkhfkeltlglellskidavimGrkTyeslpvrplpgrln
00447101   1/1  --kislivAvsldgvIGldgdlpWlllpedlkyfkaltlgdavvmGrkTfeslprplpgrlniVlsrsld
00533181   1/1  ---iilivavsldgvigkdgdlpwllpedlkhfkeltagdavlmGrkTyesipgrplpgrlniVlsrsld
00463191   1/1  --kiilivavsldgvIgkdgdlpwllpeDlkhfkeltlgdavimGrkTyeslplglrplpgrlniVlsrs
00533781   1/1  ---lrpvtlivavsldgvialdgdlpwltlpedlklfkeltagadflgkidailmGrkTyesdgpklrpl
00362281   1/1  -pkvilivavsldgvig.dgdlpwilpedlahfkeltagvdavlmGrkTfesippplpnrlniVlsrslr
00530541   1/1  -PfvtlklAmslDgkialadgdspwitgedralvhrlralvdailvGrgTvladnPlltvrlvglrqPlr


                         -         -         *         -         -         -         -:140
query           HIEGADVVGSIEDAQRLCIGAEQVFLIGGAQLYAEALPSADRLIVTEIDADVEGDAFFPAVDRTTWVETA
00533431   1/1  gRlniVlsrdldlsadegvlvvgsleealellkellleelllgveevfviGGaeiyklalelpladrlyl
00478351   1/1  lniVlsrdldllalegvlvvgsleealellkelalllgveevfviGGaeiyklalelpladrlylTripa
00393491   1/1  lllkllrlllllktsgeedlgyheflktgnavimGrkTfeslpekfrplpgrlniVlsrslklelldegv
00491391   1/1  p.egvlvvgsleealallkggkdvfviGGaelyaqllglvdelyltvipvllgggtplpeldldlwllll
00351271   1/1  grlniVlsrsldlsllaegvlvvssleealallkgiedvfviGGaelykelleaplvdeliltripvllg
00476881   1/1  lsrtlrdldllaegnvvlvvgsleealallkelldeldllellllllaaggkdvfviGGaelyaqflglv
00430511   1/1  iVlsrslkldllaegvlvassleealellkeelgieeifviGGaelykefleaplvdelyltripvllge
00447101   1/1  lsldegvlvvgsleealallkelgveevfviGGaelyalllpladelyltripvllggdtflpeillsdf
00533181   1/1  lvaegvtvvgdleealallkeaggkdvfviGGaelyaqllglvdelyltvipvllggdtlfpgldlldle
00463191   1/1  ldllaegvlvvgsleeala....gkdifviGGgelyaqflglidelyltvipvllgslggdtlfpeld.s
00533781   1/1  pgrlniVlsrsldlplegvvvvsgdleealallkeallllgikdvlviGGaelyasfleaglvdelylti
00362281   1/1  lpldgnvvlvagdleealallkergiedvlviGGaelyaslleaglvdeliltvipvllgegdtlfpgld
00530541   1/1  vvldsslrlpldaklfplpgrptivltrseallaegvevlvlgrvdleellellaerginsvlveGGgtl


                         +         -         -         -         -         *         -:210
query           RELHHSETNGFDYAFVTYERPASGEE--------------------------------------------
00533431   1/1  Tripvllegdtffpeidlsewk------------------------------------------------
00478351   1/1  llegdtffpeidlsewklvl--------------------------------------------------
00393491   1/1  lvvnsleealkllkklgiee--------------------------------------------------
00491391   1/1  esrvladgvvllryrfvtyer-------------------------------------------------
00351271   1/1  sgfeldtffplidlskfklv--------------------------------------------------
00476881   1/1  delyltvipvllggdtlfp.ldl-----------------------------------------------
00430511   1/1  gdtlfpeldlslllelvse.--------------------------------------------------
00447101   1/1  elv......deenllnylfll-------------------------------------------------
00533181   1/1  lvssetlgdgvvllrYrflvle------------------------------------------------
00463191   1/1  ewklvlletvvldeg.lryef-------------------------------------------------
00533781   1/1  apvllgggtlfpgldlslwlel------------------------------------------------
00362281   1/1  ealrlelvsvevlgedgv----------------------------------------------------
00530541   1/1  agsflglvdeliltiapkll--------------------------------------------------