[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF09485.1


[Show Plain Result]

## Summary of Sequence Search
   1::149
   1::147  1.2e-45 46.9% 0041377 00413771 1/1   YqeY motif                              
   1::149


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSLKARINDDMKAAMRAREAERLGTVRLLLAAIKQREVDERIELDDAGITAVIDKMIKQRKDSISQFEQA
00413771   1/1  mslladlfedlkaamkakdklrlntlrlllaalkneevdlgeleltdeellevlklivkqrkesieelle


                         -         -         *         -         -         -         -:140
query           GRDDLVAKEKAELDVLVAYMPAQLSDAEVAAEVQKAVTESGAAGPQDMGKVMGLVKARLAGRADMTAVSA
00413771   1/1  ggredlaekekaeieileeylleqlsdeeleaivdeviaelgagklkamgklmgavmkklkGkadgklvs


                         +         -         -         -         -         *         -:210
query           LVKAALAPK-------------------------------------------------------------
00413771   1/1  ellkekL---------------------------------------------------------------