[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF09628.1


[Show Plain Result]

## Summary of Sequence Search
   1::188
   2::187  1.4e-48 35.1% 0051089 00510891 1/1   se-like                                 
   1::168  6.3e-42 34.0% 0041842 00418421 1/1   se-like                                 
  28::175  1.5e-26 29.4% 0036608 00366081 1/1   se-like                                 
   2::182  3.5e-25 27.4% 0050315 00503151 1/1   se-like                                 
  40::182  1.6e-22 27.0% 0049409 00494091 1/1   se-like                                 
  16::182    3e-22 27.5% 0042623 00426231 1/1   se-like                                 
  29::184  1.6e-21 29.1% 0037428 00374281 1/1   se-like                                 
  32::183  4.9e-21 23.3% 0052042 00520421 1/1   se-like                                 
   1::182  7.6e-21 23.4% 0049218 00492181 1/1   se-like                                 
  82::160  4.3e-07 25.0% 0052041 00520411 1/1   se-like                                 
   1::188


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSIKSDKWIRRMAEQHGMIEPFEPGQVRESDGRKIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
00510891   1/1  -milsdkdIlellekgliviepfldee............qiqpasydlrlgnefrvfrniflaiidlkll
00418421   1/1  M.ilsdkeikklllkgalvieppveati.............gsaGyDLrlaneflvfrnsvlgvidlkna
00366081   1/1  ---------------------------rlsenaelpsyatlgsagyDLraa...................
00503151   1/1  -mllsdkiivkrlseg..allplratl.............gsagyDLrlaedvvikpg..etalvptgla
00494091   1/1  ---------------------------------------iqpasldlrlgnellvf.klgdgailpkrat
00426231   1/1  ---------------mlmlidleilvkllsegallptratagsagydLraa...................
00374281   1/1  ----------------------------llenallplratlgsagydLraa...................
00520421   1/1  -------------------------------lelplyatpgdAglDLraped..................
00492181   1/1  lmllsdleilvlllsgglll.ptratlg.............sagyDLra.....................
00520411   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EKSFVDFKGDVCIIPPNSFALARTMEYFRIPRSVLTICLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
00510891   1/1  delllplyategsagldllldegfvlePgevylvptgeaialPeglaalvlpRSslarlgllvlntagvi
00418421   1/1  drllieelllllsaelnlellelleidldedlvLpPgefylvptgeaielPedvaalilpRSslarlgif
00366081   1/1  ..........edvvlppgetalvptglaialppgyaglilgrSslarkgllvlagvidpgYrgeitvilf
00503151   1/1  iellle..gdlfillpgsfvlavtlelvklpegyvalilpRSslaklgltvlntagviDagYrGeitvll
00494091   1/1  agsagldlraaed.....vvlpPgetalvptgeaialpeglvglilpRSslarkglivllntagvidpgY
00426231   1/1  ..........edivlpPgetalvptglaialppgyaglllgrsslalklgltvlagvidpgyrgeiklil
00374281   1/1  ..........edivlpPgetvlvptglaialppgyaglllgrsslarkgllvlpgvidpgyrgeitvllf
00520421   1/1  ...........ivlpPgetvlvptglaialppgyaalilgRSslalkgliglidp...gyrGeiklillN
00492181   1/1  ......aedepvvlppgetalvptglaielpdkglaglilpRSglarkglivllntagviDpdYrgeikv
00520411   1/1  -----------ivlpPgetalvptglaialppgyaalllgrSglalkgl...vgvidsgyrGeikvilln


                         +         -         -         -         -         *         -:210
query           TTPLPAKIYAGEGCAQVLFFESDEICETSYADRGGKYQGQQGVTLPKT----------------------
00510891   1/1  DpgyrgeitlelvnlgklpfrlypgeriaQlvfepvlgpveelygte-----------------------
00418421   1/1  vlntaGviDpgYrGeitlelvnlg.lpv------------------------------------------
00366081   1/1  nlgdlpvtikkgdriaqlvflpvltpeleevselg-----------------------------------
00503151   1/1  ynlgdepvtikkgdriaQlvflpv.....lsetergygGfGs----------------------------
00494091   1/1  rgeitlllfnlgdelpvtikkgdriaqlvflpllgpaleeyd----------------------------
00426231   1/1  fnlgdlpvtikkgdriaqlvflplltpeleeveelsgtyrgd----------------------------
00374281   1/1  nlgdlpvtikkgdriaqlvflpllspeleevselsesergdggf--------------------------
00520421   1/1  lskepvtlkkgdriaqlvllplelvellpdterggggfgstgv---------------------------
00492181   1/1  ilfnlgdepvtikkgdriaQlvflpvltaeleevdelseter----------------------------
00520411   1/1  lgdepvtikkgdriaqlvll--------------------------------------------------