[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF09694.1


[Show Plain Result]

## Summary of Sequence Search
   1::289
   1::167  9.9e-46 45.1% 0048755 00487551 1/1   )-binding Rossmann-fold domains         
   2::163    7e-45 39.2% 0048757 00487571 1/1   )-binding Rossmann-fold domains         
   2::163  1.3e-43 46.8% 0052329 00523291 1/1   )-binding Rossmann-fold domains         
   2::162  1.5e-40 41.0% 0050269 00502691 1/1   )-binding Rossmann-fold domains         
   1::161  2.3e-34 42.9% 0052837 00528371 1/1   )-binding Rossmann-fold domains         
   2::160  4.8e-33 38.0% 0050910 00509101 1/1   )-binding Rossmann-fold domains         
   1::158  1.8e-30 37.7% 0035535 00355351 1/1   )-binding Rossmann-fold domains         
 163::286  4.2e-30 37.1% 0050268 00502681 1/1   sphogluconate dehydrogenase C-terminal  
 164::286  1.8e-29 37.4% 0052328 00523281 1/1   sphogluconate dehydrogenase C-terminal  
   2::162  2.8e-29 35.7% 0051873 00518731 1/1   )-binding Rossmann-fold domains         
   2::160  4.2e-26 33.6% 0051797 00517971 1/1   )-binding Rossmann-fold domains         
   1::189  7.9e-24 28.8% 0047550 00475501 1/1   )-binding Rossmann-fold domains         
   1::164  4.4e-19 30.8% 0050443 00504431 1/1   )-binding Rossmann-fold domains         
   3::124  6.6e-19 28.0% 0051305 00513051 1/1   )-binding Rossmann-fold domains         
   2::139  8.9e-18 23.3% 0045243 00452431 1/1   )-binding Rossmann-fold domains         
   2::139  1.1e-17 27.8% 0038057 00380571 1/1   )-binding Rossmann-fold domains         
   1::163  7.2e-17 25.2% 0042866 00428661 1/1   )-binding Rossmann-fold domains         
   2::139  5.1e-16 26.5% 0048808 00488081 1/1   )-binding Rossmann-fold domains         
   1::163  7.5e-15 22.2% 0048102 00481021 1/1   )-binding Rossmann-fold domains         
   2::118  3.3e-12 27.8% 0047032 00470321 1/1   )-binding Rossmann-fold domains         
   2::144  8.7e-12 15.9% 0047510 00475101 1/1   )-binding Rossmann-fold domains         
   2::96   2.1e-11 26.6% 0042340 00423401 1/1   )-binding Rossmann-fold domains         
   2::121  3.3e-11 25.9% 0049007 00490071 1/1   )-binding Rossmann-fold domains         
   1::86   1.5e-09 28.9% 0048687 00486871 1/1    N-terminal domain                      
   1::131  1.8e-09 25.2% 0036785 00367851 1/1   )-binding Rossmann-fold domains         
   1::121  5.4e-09 21.9% 0042534 00425341 1/1   )-binding Rossmann-fold domains         
   1::121  1.9e-08 23.9% 0047992 00479921 1/1   )-binding Rossmann-fold domains         
   1::117  5.5e-08 30.1% 0047178 00471781 1/1   )-binding Rossmann-fold domains         
   1::127  7.1e-08 25.4% 0050228 00502281 1/1   )-binding Rossmann-fold domains         
   3::128  9.6e-08 25.0% 0041129 00411291 1/1   )-binding Rossmann-fold domains         
   3::99   1.1e-07 28.9% 0037437 00374371 1/1   )-binding Rossmann-fold domains         
   2::155    3e-07 24.3% 0042180 00421801 1/1   )-binding Rossmann-fold domains         
   3::114  3.4e-07 28.8% 0044526 00445261 1/1   )-binding Rossmann-fold domains         
   1::115    1e-06 28.2% 0046897 00468971 1/1   )-binding Rossmann-fold domains         
   2::165  1.7e-06 26.7% 0047294 00472941 1/1   )-binding Rossmann-fold domains         
   1::115  1.8e-06 26.7% 0046034 00460341 1/1   )-binding Rossmann-fold domains         
   1::112  1.8e-06 27.3% 0048227 00482271 1/1   )-binding Rossmann-fold domains         
   1::208  2.5e-06 25.1% 0043041 00430411 1/1   )-binding Rossmann-fold domains         
   2::111  2.5e-06 26.9% 0036664 00366641 1/1   )-binding Rossmann-fold domains         
   1::145  3.9e-06 21.1% 0048454 00484541 1/1   )-binding Rossmann-fold domains         
   1::117    4e-06 29.5% 0049117 00491171 1/1   )-binding Rossmann-fold domains         
   2::114    4e-06 25.9% 0048469 00484691 1/1   )-binding Rossmann-fold domains         
   3::150  4.5e-06 23.2% 0035290 00352901 1/1   )-binding Rossmann-fold domains         
   3::60   4.9e-06 33.3% 0038379 00383791 1/1   )-binding Rossmann-fold domains         
   2::81   5.7e-06 34.8% 0049686 00496861 1/1   )-binding Rossmann-fold domains         
   1::138  6.1e-06 25.4% 0035477 00354771 1/1   )-binding Rossmann-fold domains         
   1::207  6.1e-06 22.4% 0043042 00430421 1/1   )-binding Rossmann-fold domains         
   1::114  1.3e-05 22.2% 0047516 00475161 1/1   )-binding Rossmann-fold domains         
   1::119  1.7e-05 33.7% 0053019 00530191 1/1   )-binding Rossmann-fold domains         
   3::109  2.6e-05 26.0% 0036746 00367461 1/1   )-binding Rossmann-fold domains         
   3::99     4e-05 23.3% 0043276 00432761 1/1   )-binding Rossmann-fold domains         
   2::157  6.1e-05 25.7% 0046357 00463571 1/1   )-binding Rossmann-fold domains         
   1::85   6.7e-05 19.7% 0044559 00445591 1/1   )-binding Rossmann-fold domains         
   3::90   8.9e-05 27.3% 0036744 00367441 1/1   )-binding Rossmann-fold domains         
   2::71   9.2e-05 32.9% 0050869 00508691 1/1   )-binding Rossmann-fold domains         
   1::117  0.00013 21.3% 0046574 00465741 1/1   )-binding Rossmann-fold domains         
   3::109  0.00017 24.0% 0040551 00405511 1/1   )-binding Rossmann-fold domains         
  10::90   0.00018 32.5% 0039935 00399351 1/1   )-binding Rossmann-fold domains         
   1::105  0.00019 27.8% 0040043 00400431 1/1   )-binding Rossmann-fold domains         
   1::75    0.0002 28.4% 0050914 00509141 1/1   )-binding Rossmann-fold domains         
   8::87   0.00023 26.7% 0051183 00511831 1/1   )-binding Rossmann-fold domains         
   1::127  0.00026 23.1% 0036007 00360071 1/1   )-binding Rossmann-fold domains         
   3::202  0.00028 24.5% 0048516 00485161 1/1   )-binding Rossmann-fold domains         
   1::117  0.00029 22.1% 0049357 00493571 1/1   )-binding Rossmann-fold domains         
   1::117   0.0003 27.9% 0052722 00527221 1/1   )-binding Rossmann-fold domains         
   1::165  0.00035 23.8% 0046673 00466731 1/1   )-binding Rossmann-fold domains         
   1::105  0.00037 26.2% 0038324 00383241 1/1   )-binding Rossmann-fold domains         
   1::117  0.00039 22.4% 0050721 00507211 1/1   )-binding Rossmann-fold domains         
   3::60   0.00045 29.3% 0051327 00513271 1/1   )-binding Rossmann-fold domains         
   2::149  0.00047 24.5% 0048186 00481861 1/1   )-binding Rossmann-fold domains         
   1::117  0.00048 25.0% 0046472 00464721 1/1   )-binding Rossmann-fold domains         
   2::62   0.00056 34.4% 0052565 00525651 1/1   )-binding Rossmann-fold domains         
   1::65   0.00062 23.1% 0044044 00440441 1/1   )-binding Rossmann-fold domains         
   2::52    0.0009 27.5% 0040651 00406511 1/1   )-binding Rossmann-fold domains         
   3::53   0.00097 31.4% 0047481 00474811 1/1   )-binding Rossmann-fold domains         
   3::79   0.00099 23.4% 0045481 00454811 1/1    N-terminal domain                      
   1::289


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTTVAFIGLGAMGAPMVGHLIRAGHTVRAFVRRPEAADAARQLGAEPFFTPAEAAQGAAVVFTNVTSSED
00487551   1/1  mm.kigviGlGlmGlplalnlakagheVvvydrnpekvealkelgapilelknltaatsleelvellkda
00487571   1/1  -llmkigfiGlGvmGlnlalnllkagfevtvynrtaekaeelvaegalelkllgalvaeslvealekadv
00523291   1/1  -kkvgviGlGlmGlalalnlak.gfevvvydrtpekaealaelgav.aaslaealaeadvvilavpapaa
00502691   1/1  -kkvgiiGlGlmGlalarnlaaaGyeVvvydrspeklealaalgaevaaslaealadadvvilavplpaa
00528371   1/1  mkkvgiiGlGlmGlslalalaraGfadeVvgydrnpeklekalelgatdliaatdlaealkdaDvvilav
00509101   1/1  -mkigiiGaGnmGralaagLlkaGhsevtvanrtpekaealaeeggvvaaslaealadadvvilavk.pq
00355351   1/1  GkkvaviGlGsmGlalAallaaaGheVlvwdrdpekveelaelgapvakylpglellgrlrattdleeal
00502681   1/1  ----------------------------------------------------------------------
00523281   1/1  ----------------------------------------------------------------------
00518731   1/1  -mkiaviGaGnyrlyaaagitnfaraaevaeevgkpeialthstitlgaelkelalgldevvlgepvfmG
00517971   1/1  -mkigiiGaGnmGsalakgllkaghevvvadrspekaeelaeelgvtaatsleelledaDvvilavp.pq
00475501   1/1  Mk.iaiiGGtGniGsalAlrLaaaGheVvvvsrspekaealaeeglnllylpgvtaadlaeaaegaDvvi
00504431   1/1  lmeikkvaviGaGlmGlgiAavlaraGleVvlvdinpealeraldeiaklllklvlkgllvelllgaala
00513051   1/1  --naesvaelalalllalarnlleaaallragiwrllpllglelagktvgviGlGriGravarrlaafGa
00452431   1/1  -tisvaelalalllalarnlpgaapllragiwrasdllglelkgktvgviGlGriGlalarllaalGakV
00380571   1/1  -ktvGiiGlGriGravakrlkafgmkvivydrspakaeeaaelgattvvsldellaeaDvvvlhvpltpe
00428661   1/1  mfltlnvrelliklkllrlggleellvlalvyydddadlellkgkkiaviGyGsmGlaiAlnLrdsgldV
00488081   1/1  -ntesvaelvlalllalarrllealalvraglwslllllglelrgktvgiiGlGriGlalarrlaafgmk
00481021   1/1  lllmlkmmkiaviGaGavGtalAallaengheVtlwdrneekvellnekgenpiylpglelpenltattd
00470321   1/1  -llGdntdglgavellerlggdlkgktvlviGaGgiGravaralaaaGakrvvvanrtpekaeelaeelg
00475101   1/1  -sepiadtvlvlilnllrdllgarqrlsagllrlkpllglelkgkkvviiGaGnvGralakvlralGaev
00423401   1/1  -aGylavllaalllcrflgglgllltlagglagkkvlviGaGgvGlaaarllaalGakVtvldrnpekle
00490071   1/1  -ktvgiiGlGriGlavakrlaafGaeVlvydrspkk.....algaevv.sleellaeadvvvlhvpltpe
00486871   1/1  llllllkikkvafiGlGgmGmsalAllllkaGyeVtgsDlndpallelleelgievvlghdaelladadl
00367851   1/1  kgkkvlviGaGgiGralaraLaeaGaevtvadrslekaealaaelggveavelDvtdeasldaalgdaDv
00425341   1/1  lsmvlkgkkvaviGaGliGlalalllallglgeVvlyDinpekleglaadladilelllvkgrirattdl
00479921   1/1  pkkvaviGaGavGlalAlalaraGaageVvlvdrdeerlealaadledllellgvdlrattdleealkda
00471781   1/1  mmmmkvlvtGAtGfiGsalvrelleagheVtalvRdpsklaall.............glgvevvvgDltd
00502281   1/1  mmkvlitGAtGfiGselvrlLlehgdhevtaldrrtsagkllnep.............gvevvegdltdp
00411291   1/1  --esvaelalalllalarrlllaarllraglwvlsllllllllllglelagktvGiiGlGriGravarrl
00374371   1/1  --agrlavleaalllervltglgalagllpgkrvlViGaGgiGleaAaalarlGakVtvvdrrpellerl
00421801   1/1  -DgigavsllkrllvdlpgkkvlvlGaGgiGralalalaaagaevvvvnrtlekaeelaeelgaqgdvsd
00445261   1/1  --pkslpllelallltglltawlplllagllpgktvgviGlGgiGlavarlakalGarViaydrspekle
00468971   1/1  k.tvlvTGatGgiGsalaraLlarpGaeVvaldrlsspeklealaallgal.........gvefvqgDlt
00472941   1/1  -mkiGliGfGevgqalasdlrergvevlaalklrsedlrelaaelgvelvss..elvlesdlvlsavtas
00460341   1/1  gktvlvTGatGgiGsalaraLlarpGaeVvaldrltsagspeklealaael............gvefvqg
00482271   1/1  m.kiaviGaGyvGlplAallaeaGheVvgvDideekvealnd.gilpilepgleellrdlldagrltatt
00430411   1/1  MsgkkvlvtGAtGfiGshlaraLleaGhevvalvRspekaalalalelleelaa....pgvevvegDltd
00366641   1/1  -ntesvaelalalllalarrlpeaaagvrtgkwlllggllgrelagktvgviGlGniGlavarrlaalGa
00484541   1/1  mmkklkvaiiGaGniGlalarallalaggaevvavadrdpekaglalakelgatttvnavddleelladp
00491171   1/1  k.tvlvTGatGgiGsalaraLlallllslaGaevvaldrspseealealael.........lalggvefv
00484691   1/1  -DgigavsllkrlgvdlpgkrvlviGaGgagraaalallalgaevtvvnrtlekaeelaelladevvald
00352901   1/1  --fgalnlgrlllgllglvpctplgilellerlgidlsgkvalVtGasggiGraiallLaraGatVtvtd
00383791   1/1  --pkdvdlrvllllpeigltalealkrallelkpgsrVlviGaGgvGsaaaqllaaaGvg----------
00496861   1/1  -AasilllgltsylallevlkikegkkVlvtGAtGgiGlavvrlllkrGykViaidrseekleklkelga
00354771   1/1  MlkgmkvlVtGAaGgiGsalalrlaarglagldllvevvlldrseal.ealegvaldlsd.......gal
00430421   1/1  MkgmkvlvtGgtGfiGshlvraLleaGhevvvlvRnpskgkaaklelleellg.....lgvevvegDltd
00475161   1/1  hgkkvgiiGlGniGkavakllkgfgmevlaydrrpke........gavyvsldellaesDvvvlcapl..
00530191   1/1  kmmkvavtGAtGyiGralvrlLlerghpvvalvrlassasa...............gkgvevvlgdltdl
00367461   1/1  --lellsvalhallraglvpGktVlviGaGgiGlaaalaakalGakViatdrspekleqakelgadfvvv
00432761   1/1  --lplelaaalglalltavlavlaagvkpgktvlvlGaGgvGlaaaqlakalGakVvavdiseeklelak
00463571   1/1  -mKiaviGaGyvGlelAavla.lgheVtlvdinpeklealnegllpilelgldelveellgnltattdle
00445591   1/1  pkkvaviGaGgvGlalAlllaaagggdVtlvDidpekleglaadlldilelllve.........rlittt
00367441   1/1  --llglafgtgfllllelagvlpgktVlvfGlGgvGlaaillakaaGagrviavdlndeklelakslGad
00508691   1/1  -ktlaiiGaGvqaraqalallavrpieevrvydrdpekaealaarlaallgldvevadsleeavrgaDiv
00465741   1/1  MgktvlvTGatGgiGsalaraLlarGaeVvlldrspsslllllekleelaaelealg.......ggvefv
00405511   1/1  --tvlvtGaGgvGlaaaqlaaalGarViavdrseeklelarelgadvvidvtdedlveavleltggvDvv
00399351   1/1  ---------kskktilVtGATGylGrsvvraLlergypVralvRnpskakalallklpgvevvrgdlldp
00400431   1/1  MgkkvLvTGgtGfiGsalvraLlerGaevvvldrdpegaaellallealg......gprvefvagDltdp
00509141   1/1  nkkkrvaiiGaGriGsalaralleapgfevvgvfdvdpekvgraieglpvlgvddleelleggvdvvila
00511831   1/1  -------llllmmmslegktvLVTGAtGfiGsalvrrLlerGyeVvaldrspekleelaallealggdp.
00360071   1/1  lellllialenllllllllllellllsllkpmkVlVtGAaGfiGshlalrLlsgglagldqlvevvlldr
00485161   1/1  --lsleeaAalplagltaylallllldlagllpgktvlvtGAaggiGsaaaqllaalGarViavdrseek
00493571   1/1  llsllsslldllslkgktvlvTGatGgiGsalaraLlarGaeVvlldrspekleelaaelealggslll.
00527221   1/1  llllkillslkgkkvlvtGAtGgiGralvkellargavskvialvRrpekleelaae.............
00466731   1/1  mlkikkvaViGaGlmGsgiAavlaaaGikVvlvDidpealekalkrilklleklvklgllsaaealllll
00383241   1/1  MgkrvLvTGgtGfiGshlvraLlerpGhevvvldrlpsgadallellalltlllslleklllllellgpr
00507211   1/1  ldmmslmgktvlvTGatGgiGsalaraLlarGaeVvlldrspekleelaaelea........lggvefvq
00513271   1/1  --tVlviGaGgvGllaiqlakalGagrViatdispeklelakelGadhvinyrdedlvea----------
00481861   1/1  -kkvlvtGAsGgiGsalalllaargaevvlldrspeklegvaldl.........sdlgvevvvadltdpe
00464721   1/1  MgktvlvtGatGfiGsalaraLlarGaveVvaldrspe............................Dltd
00525651   1/1  -lrlaiiGlGliGgslalalrkaglevvgvdrseetlelalelglvdeaatdlealagadlv--------
00440441   1/1  plrigivGlGrigqkahlpalaalpgvelvavvdrdpekaealaellgvpvydsldelladvdaV-----
00406511   1/1  -mhviiiGlGrvGlalarlLlelgidvvvidideerveelrelgvlvvvgda------------------
00474811   1/1  --tVlvtGAaGgvGlaavqlakalGarViatdrspeklelakelGadhvidyr-----------------
00454811   1/1  --rVvViGaGlsGlaaarlllrlGaevtvldrrdrpggllllelgvefvlgslllellleadlvvlspgv


                         -         -         *         -         -         -         -:140
query           VREVLLGRNGVVEGAAPGTICVDHSTISPIVTREIAQALAACGIEALDCPVSGGTVGAQAATLTIMVGGK
00487551   1/1  dvvilavptpsavkevl...egllpllkpgaividtstvspgtteelaklleekgilfvdapvsggpaga
00487571   1/1  vilmvpagaavdevl...dgllpllkkgdiiidgstsspedtrrlakllkekgilfldapVsGgeagaen
00523291   1/1  vrevl...egllpllkpgaividlstgspldtealaealeekgilfldapvsggepgaragpltimaggd
00502691   1/1  vkavlnglaellallkpgailidvssglpvdtealaaalaeggilvaglpvfggepgaglgvltphvggd
00528371   1/1  p.tpavrevl...eellpllkpgailidvssgkpittealaeal...gervigahpvsggevgapegala
00509101   1/1  aveevlaelag......kgalvidiaagip..ieelaealpeaglvvrdmpnlgalvgagataltllagg
00355351   1/1  adaDvvilavpt.pavrsvl...aelapllkpgaivvdlstglvgtieallaallegvlalagldvldap
00502681   1/1  ----------------------------------------------------------------------
00523281   1/1  ----------------------------------------------------------------------
00518731   1/1  sgiAlvadevlaeagmkvaligisgligsslaralkkkgkevivsnrsaatlerleelGvkvttdlaeAv
00517971   1/1  lveevl.......kalkpgklvidvaagidi..ealaealkeggivvrvapntgalvgagatalvagagv
00475501   1/1  lavp.peavrevl...eelapll.egkivvdvtnglpidtllll.........vlsgpslaeevaellpg
00504431   1/1  ritgttdlealadadlVieavpenldvklavl..aeleallkpgailas.ntssls.italadalgrpgr
00513051   1/1  eVivydrspea.aealelgatvv.sleellaeaDvvilavpltpetkglinae.----------------
00452431   1/1  ivydrspekleel...dglgvdsleellkeaDvvilavpltpetkglin..aellallkpgailvnvar-
00380571   1/1  trgli..naellallkpgailintargglvdeaallealesggiagaglDVfepeplvdgpllglpnvi-
00428661   1/1  vlydrnevglrkgssslekaeelgvillvltvadlaeavagADlvilavpd.eatadvl...eeiapllk
00488081   1/1  Vlvydrspkaaaa....gaaeavsleellaeaDvvvlhvpltpetrgli..naellallkpgailinta-
00481021   1/1  leeavkdadlviiavpt.dalrsvlrqlakllkdvllkkgaiivsltsgipvgtlallseiieevlgghp
00470321   1/1  geavsldelaealaeaDivinatpaglpvitlellepglllallkkga----------------------
00475101   1/1  tvydidesrleel...dgrvvdsledllkdaDvviiatplnlsteglln..deilkklkegailinvsrg
00423401   1/1  qleelgadavevdvsdtadleelvae--------------------------------------------
00490071   1/1  trgli..naellallkpgailinvarggvvdeealldalksgkiagaalDV-------------------
00486871   1/1  vvvslaipldnpella------------------------------------------------------
00367851   1/1  vinaapvglh.......aeiveaaleagkhvvdenpla.aetralleaakeagvgrivnvs---------
00425341   1/1  yealkgaDvviiavgvprkpgl.......iaellkrgdllvtnasilvdii-------------------
00479921   1/1  Dlviiavgvp............lkpglvrldlasnnsgividvlaallklp-------------------
00471781   1/1  paslaaalagvdaVihlag.padpldllevnvdgtrnlleaakaagv-----------------------
00502281   1/1  ddlekalkgvDvvihaagtsrvdeslkdalgtnvigtssalrllnlleaakeagvkr-------------
00411291   1/1  kafgmkvivydrspskaaeavalg.aevvsleellaeadvvvlhvpltpetrgli..n------------
00374371   1/1  eelgakfvlltldeelvevvlaltvdvsd-----------------------------------------
00421801   1/1  leeleealggaDivvnatgaglpg....lllelllellkpggvvvdvaypp.llttallplararglgri
00445261   1/1  lakelgadfvvvysdedsleellkgaDvvilhvpltlaleevle--------------------------
00468971   1/1  dpeslaaalagvridvvihnAgiv..lvdlseedpeevldvNvlg-------------------------
00472941   1/1  a.alevakslapvlsg.....iyvDlNsvsPetkrraaeliekgg..fvdaaimgpvpplrlkvpillaG
00460341   1/1  DltdpeslaaalagvriDvvihnAgivsv..dlseedpeevldvN-------------------------
00482271   1/1  dlaealadadvviiavgtpldadggadlsyvlaaaralakvl----------------------------
00430411   1/1  peslaealkgvdvVihlag.........dvnvlgtlnlleaakkagvkrfvfvSsagvygdedtplppls
00366641   1/1  kVivydrspralee...lgadvv.sleellaeaDvvvlavp-----------------------------
00484541   1/1  gvDvvieatpagahaevalaaleagkhvvvekptaltveeavvpl...velvelaeekgvvlgvgfgvrf
00491171   1/1  qgDltdpeslaaalagvdvvvhnAgivsv..dlseedpeevldvNvl-----------------------
00484691   1/1  lddleealggaDlvinatgagmag....lvlplllsllkpggvv--------------------------
00352901   1/1  rnten..............leeavkeaDivivavgvpg.....lvkaell....kpgavvidvdvtdped
00383791   1/1  ----------------------------------------------------------------------
00496861   1/1  d..........-----------------------------------------------------------
00354771   1/1  avlldltdtddlaealkgadvvvhlagvprkpgedrddllavnvlgtralleaarkagvgrivvvssg--
00430421   1/1  peslaealkgvDvVihlagl.....evidvnvlgtlnlleaakeagnvkrfvfvSsagvygdedtplnpl
00475161   1/1  .....eaineealaalkkgailintsrgalvdeeallelleagk--------------------------
00530191   1/1  dllaaalagvdvvflaaga............gatlalaeaaaaagvkvi---------------------
00367461   1/1  ykdlsediieavaellatngggadividtagipg.....-------------------------------
00432761   1/1  elGadfvvvykdedvaeavleltggadvv-----------------------------------------
00463571   1/1  ealkdaDlviiavgtplkdgdgrpdldivnavaeeiakllgpdtivv.sstvpvgtteylatpll..gid
00445591   1/1  dleealadaDvviia-------------------------------------------------------
00367441   1/1  lvvnpkdldeevaeavlelt--------------------------------------------------
00508691   1/1  i---------------------------------------------------------------------
00465741   1/1  qgDltdpeslaaaleevgvdvvihnAgi..plvdlseedpeevldvN-----------------------
00405511   1/1  vdaagvpa.......tleealrllkpggrlvlvgvaggl-------------------------------
00399351   1/1  eslleaalggvdvvflvtsf--------------------------------------------------
00400431   1/1  ealeaalagvdaVvhlAalshv..dlseedpeevl-----------------------------------
00509141   1/1  vPa.e-----------------------------------------------------------------
00511831   1/1  ....gvelvvgDltdpe-----------------------------------------------------
00360071   1/1  leslekleglaldlsda..........atfllgdvsdtadleealkgadvvvhlAgv-------------
00485161   1/1  lellkelgad..............vvidvtdedaveal...........agggvdvvvnnaggatlgall
00493571   1/1  .ggvefvqgDltdpesleaalagvdvvvhnAgivgv..dlseedpee-----------------------
00527221   1/1  gvevvvgDltdpeslaealkgvdvvinaagttrfgedleeflavnvd-----------------------
00466731   1/1  eallgritattdladaladadlvieavpenldlkkkvfaelekllkpdail..asnTsslsitelaealk
00383241   1/1  vefvegDltdpealaaalaefggvdvVihlAalvh-----------------------------------
00507211   1/1  gDltdpeslaaalagvriDvvvhnAgi..plvdlseedpeevldvNv-----------------------
00513271   1/1  ----------------------------------------------------------------------
00481861   1/1  slaealkgadvvviaagiprkpgedrldlldvnvlgvknlleaaakagvgrivlvssnpvdglayaaska
00464721   1/1  peslaaalagvrvdvvihlAgivsav.dlseedpeevldvNvlgtln-----------------------
00525651   1/1  ----------------------------------------------------------------------
00440441   1/1  ----------------------------------------------------------------------
00406511   1/1  ----------------------------------------------------------------------
00474811   1/1  ----------------------------------------------------------------------
00454811   1/1  pldhpllel-------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AEVLEKVRPLLEQIGKTITHIGDSGAGQVAKLCNQIAQVVNIEGIAEAMRFAGAQGVDTAKVFQAMSTGM
00487551   1/1  glg.ltilvggdeealekvkpllealg-------------------------------------------
00487571   1/1  G.lsimvGGdeeafervkpilea-----------------------------------------------
00523291   1/1  eealervrpllealg.avvyvgd-----------------------------------------------
00502691   1/1  eealervlpllealgktvvvlg------------------------------------------------
00528371   1/1  dlfegplviltpmaggdeeal-------------------------------------------------
00509101   1/1  deealelvepllealgkvvv--------------------------------------------------
00355351   1/1  lsgpeflaeggalllvan----------------------------------------------------
00502681   1/1  ----------------------pvGaGqaaKlvnnlllavllaalaEalalaekaGldlavllevlsggs
00523281   1/1  -----------------------vGaGqaaKlvnnlllavllaalaEalalaekaGldlekllevlsgga
00518731   1/1  kgADivilavppgdavldvl..------------------------------------------------
00517971   1/1  deealelvlellealgkvvv--------------------------------------------------
00475501   1/1  arvvkafntiaaarladlfaglgflvlvagdde...........ealkl---------------------
00504431   1/1  viglhffnpvplmplve.lvpgeg----------------------------------------------
00513051   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00380571   1/1  ----------------------------------------------------------------------
00428661   1/1  pgailsfahGisidelalagill-----------------------------------------------
00488081   1/1  ----------------------------------------------------------------------
00481021   1/1  favlsgPefarevaeglptavti-----------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00475101   1/1  glvd------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00490071   1/1  ----------------------------------------------------------------------
00486871   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00471781   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00411291   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00421801   1/1  vdglsmlvlqg.apg-------------------------------------------------------
00445261   1/1  ----------------------------------------------------------------------
00468971   1/1  ----------------------------------------------------------------------
00472941   1/1  peaeelke....lnelglnlevige---------------------------------------------
00460341   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00430411   1/1  pygasKaaaeallral....glpvtivrpgnvygpglsgiplllrlalkggpllilgdgdakrdfvhv--
00366641   1/1  ----------------------------------------------------------------------
00484541   1/1  lppvv-----------------------------------------------------------------
00491171   1/1  ----------------------------------------------------------------------
00484691   1/1  ----------------------------------------------------------------------
00352901   1/1  vealgdvale------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00430421   1/1  spygasKaaaekllra.sglpvtilrpgnvygpglsgliplllklalkggpllilgdgdqkrdfihv---
00475161   1/1  ----------------------------------------------------------------------
00530191   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00432761   1/1  ----------------------------------------------------------------------
00463571   1/1  vlssPeflregaallhl-----------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00367441   1/1  ----------------------------------------------------------------------
00508691   1/1  ----------------------------------------------------------------------
00465741   1/1  ----------------------------------------------------------------------
00405511   1/1  ----------------------------------------------------------------------
00399351   1/1  ----------------------------------------------------------------------
00400431   1/1  ----------------------------------------------------------------------
00509141   1/1  ----------------------------------------------------------------------
00511831   1/1  ----------------------------------------------------------------------
00360071   1/1  ----------------------------------------------------------------------
00485161   1/1  el.lapggrvvlvnllggllltral...............lplllkrgkgrivns.......--------
00493571   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00466731   1/1  rpervlglhffnPvrlmp...lvEi---------------------------------------------
00383241   1/1  ----------------------------------------------------------------------
00507211   1/1  ----------------------------------------------------------------------
00513271   1/1  ----------------------------------------------------------------------
00481861   1/1  alegsgldv-------------------------------------------------------------
00464721   1/1  ----------------------------------------------------------------------
00525651   1/1  ----------------------------------------------------------------------
00440441   1/1  ----------------------------------------------------------------------
00406511   1/1  ----------------------------------------------------------------------
00474811   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AGSRMLDMLGPKMVTRDFSAGIESRLHAKDFGLAADIATEIGLELPAMRATSAQLGELMDQGWGKDDTSS
00487551   1/1  ----------------------------------------------------------------------
00487571   1/1  ----------------------------------------------------------------------
00523291   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00502681   1/1  ggswllelygprmldgdydpgfaldlmlKDlglaldlAeelgvplplaalalqlyaaalaaglgdldfsa
00523281   1/1  ggswllelkgprlmldgdfdpgfaldlmlkDlglalelAeelgvplpllalalelyaaavaaglgdldfs
00518731   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00475501   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00513051   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00380571   1/1  ----------------------------------------------------------------------
00428661   1/1  ----------------------------------------------------------------------
00488081   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00490071   1/1  ----------------------------------------------------------------------
00486871   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00471781   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00411291   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00445261   1/1  ----------------------------------------------------------------------
00468971   1/1  ----------------------------------------------------------------------
00472941   1/1  ----------------------------------------------------------------------
00460341   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00430411   1/1  ----------------------------------------------------------------------
00366641   1/1  ----------------------------------------------------------------------
00484541   1/1  ----------------------------------------------------------------------
00491171   1/1  ----------------------------------------------------------------------
00484691   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00430421   1/1  ----------------------------------------------------------------------
00475161   1/1  ----------------------------------------------------------------------
00530191   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00432761   1/1  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00367441   1/1  ----------------------------------------------------------------------
00508691   1/1  ----------------------------------------------------------------------
00465741   1/1  ----------------------------------------------------------------------
00405511   1/1  ----------------------------------------------------------------------
00399351   1/1  ----------------------------------------------------------------------
00400431   1/1  ----------------------------------------------------------------------
00509141   1/1  ----------------------------------------------------------------------
00511831   1/1  ----------------------------------------------------------------------
00360071   1/1  ----------------------------------------------------------------------
00485161   1/1  ----------------------------------------------------------------------
00493571   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00383241   1/1  ----------------------------------------------------------------------
00507211   1/1  ----------------------------------------------------------------------
00513271   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00464721   1/1  ----------------------------------------------------------------------
00525651   1/1  ----------------------------------------------------------------------
00440441   1/1  ----------------------------------------------------------------------
00406511   1/1  ----------------------------------------------------------------------
00474811   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LLKVLELKG-------------------------------------------------------------
00487551   1/1  ----------------------------------------------------------------------
00487571   1/1  ----------------------------------------------------------------------
00523291   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00502681   1/1  liklle----------------------------------------------------------------
00523281   1/1  alikll----------------------------------------------------------------
00518731   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00475501   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00513051   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00380571   1/1  ----------------------------------------------------------------------
00428661   1/1  ----------------------------------------------------------------------
00488081   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00490071   1/1  ----------------------------------------------------------------------
00486871   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00471781   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00411291   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00445261   1/1  ----------------------------------------------------------------------
00468971   1/1  ----------------------------------------------------------------------
00472941   1/1  ----------------------------------------------------------------------
00460341   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00430411   1/1  ----------------------------------------------------------------------
00366641   1/1  ----------------------------------------------------------------------
00484541   1/1  ----------------------------------------------------------------------
00491171   1/1  ----------------------------------------------------------------------
00484691   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00430421   1/1  ----------------------------------------------------------------------
00475161   1/1  ----------------------------------------------------------------------
00530191   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00432761   1/1  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00367441   1/1  ----------------------------------------------------------------------
00508691   1/1  ----------------------------------------------------------------------
00465741   1/1  ----------------------------------------------------------------------
00405511   1/1  ----------------------------------------------------------------------
00399351   1/1  ----------------------------------------------------------------------
00400431   1/1  ----------------------------------------------------------------------
00509141   1/1  ----------------------------------------------------------------------
00511831   1/1  ----------------------------------------------------------------------
00360071   1/1  ----------------------------------------------------------------------
00485161   1/1  ----------------------------------------------------------------------
00493571   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00383241   1/1  ----------------------------------------------------------------------
00507211   1/1  ----------------------------------------------------------------------
00513271   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00464721   1/1  ----------------------------------------------------------------------
00525651   1/1  ----------------------------------------------------------------------
00440441   1/1  ----------------------------------------------------------------------
00406511   1/1  ----------------------------------------------------------------------
00474811   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------