[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF09846.1


[Show Plain Result]

## Summary of Sequence Search
   1::873
   2::685 9.5e-146 35.8% 0038403 00384031 1/1   otidylyl transferase                    
   1::686 2.4e-130 39.3% 0039071 00390711 1/1   otidylyl transferase                    
   3::686 1.5e-127 36.5% 0037568 00375681 1/1   otidylyl transferase                    
   1::686 1.2e-119 37.4% 0038030 00380301 1/1   otidylyl transferase                    
  38::688 4.1e-114 42.2% 0043348 00433481 1/1   otidylyl transferase                    
  37::687 1.7e-106 41.2% 0052384 00523841 1/1   otidylyl transferase                    
  37::693 9.9e-105 42.7% 0042947 00429471 1/1   otidylyl transferase                    
  11::686  1.9e-90 37.6% 0040507 00405071 1/1   otidylyl transferase                    
   5::677  9.8e-86 37.0% 0039171 00391711 1/1   otidylyl transferase                    
  17::693  2.8e-84 36.9% 0038263 00382631 1/1   otidylyl transferase                    
  33::684  2.6e-72 30.7% 0047412 00474121 1/1   otidylyl transferase                    
   4::731  1.3e-53 29.7% 0039322 00393221 1/1   otidylyl transferase                    
  32::692  4.7e-52 27.8% 0035691 00356911 1/1   otidylyl transferase                    
 228::435  7.8e-52 38.3% 0037567 00375671 1/1   /IleRS/LeuRS editing domain             
 231::431  5.2e-51 42.1% 0038402 00384021 1/1   /IleRS/LeuRS editing domain             
 233::430  6.1e-48 38.1% 0049869 00498691 1/1   /IleRS/LeuRS editing domain             
  36::745  6.7e-48 27.9% 0048275 00482751 1/1   otidylyl transferase                    
  39::283  2.8e-36 29.8% 0048474 00484741 1/2   otidylyl transferase                    
 677::873  2.1e-33 34.6% 0039227 00392271 1/1   odon-binding domain of a subclass of cl 
 676::831  5.3e-26 31.2% 0039069 00390691 1/1   odon-binding domain of a subclass of cl 
   9::680    4e-25 22.3% 0039570 00395701 1/1   otidylyl transferase                    
 686::811  2.3e-23 34.4% 0038401 00384011 1/1   odon-binding domain of a subclass of cl 
 680::871  6.6e-23 23.6% 0043347 00433471 1/1   odon-binding domain of a subclass of cl 
 684::872  1.8e-19 29.4% 0037566 00375661 1/1   odon-binding domain of a subclass of cl 
 319::436    7e-12 32.0% 0046954 00469541 1/1   /IleRS/LeuRS editing domain             
 532::736  7.6e-11 19.9% 0047114 00471142 2/2   otidylyl transferase                    
  50::145  1.9e-07 29.2% 0047114 00471141 1/2   otidylyl transferase                    
 635::696  1.2e-06 32.1% 0048474 00484742 2/2   otidylyl transferase                    
 679::820  5.8e-06 13.2% 0052383 00523831 1/1   odon-binding domain of a subclass of cl 
  50::126  6.6e-05 29.2% 0053312 00533121 1/2   otidylyl transferase                    
 631::740     0.15 19.6% 0053312 00533122 2/2   otidylyl transferase                    
   1::873


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVRNYTINDVMAR
00384031   1/1  -Pgfinlklieekllkiweelklfgk.....lflpkgkkkvvvtfppPypnGplHiGHarsailgDvlaR
00390711   1/1  etalpkfynllliekkwqkfweekklfeaflpldp....gkkkfyvttppPypnGllHiGHarnyvlaDv
00375681   1/1  --lalyntlnlpleefplrynlkeieekwqkyweekklfea....llpllggkkkfyvtdppPypnGplH
00380301   1/1  ialpgfinlflieekllklweeeklfeflle.......gkkkfvvtvppPypnGplHiGHarsailgDvl
00433481   1/1  -------------------------------------kkkflvtvpppyvngllHlGHarnayilaDvla
00523841   1/1  ------------------------------------gkkkflitvpppyvngplHlGhartyilaDvlaR
00429471   1/1  ------------------------------------gkkkflitvpgpyvngllHiGHarnyilaDvlaR
00405071   1/1  ----------elklyntweekklffkpld........kkkvvvtvpgpyvngllHiGHarsyilgDvlaR
00391711   1/1  ----ynpleieeeilkkl..................kkkkvvvvrtgpyPtGplHiGhargallgdvlar
00382631   1/1  ----------------lWeeegifek......dllkgkkkfvvtrfpPsPtGyLHiGharnallndllar
00474121   1/1  --------------------------------fppgkgkkvvversspnptgplHiGHarsavigdalaR
00393221   1/1  ---kenlelierglielwreeelfell.........ekkkvrvy.tgpdPtgslHlGhlrgaikldvlar
00356911   1/1  -------------------------------pflpgkkkkvvvefssPnptgplHiGHarsaiigdalar
00375671   1/1  ----------------------------------------------------------------------
00384021   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00482751   1/1  -----------------------------------gmslllklllirgllneltdekelfellegkpvrv
00484741   1/2  --------------------------------------tk.vvvrfaPnPtGplHiGharsaligdllar
00392271   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00395701   1/1  --------tvelllelierglieqltdeelldkllngkpvrlytgfdPta.gslHlGh...lvpldklrr
00384011   1/1  ----------------------------------------------------------------------
00433471   1/1  ----------------------------------------------------------------------
00375661   1/1  ----------------------------------------------------------------------
00469541   1/1  ----------------------------------------------------------------------
00471142   2/2  ----------------------------------------------------------------------
00471141   1/2  -------------------------------------------------gmsvdellelllrglyntltd
00484742   2/2  ----------------------------------------------------------------------
00523831   1/1  ----------------------------------------------------------------------
00533121   1/2  -------------------------------------------------vdlllelllrglietltdeee
00533122   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           YLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQSMGLAIDWSREVATCSPEYYR
00384031   1/1  ylrmlGydvlfvlgiddhGlpiellaekfgedprelaeeyieeikedlkrlgisydwsreyattdpeyie
00390711   1/1  laRylrmrGydVlfvpgwDdhGlpielaaeklldiddkiprkelgreefgetprelaeeyiaeikedlkr
00375681   1/1  iGHarnyilaDvlaRylrmrGydVlfvpgwDdhGlpielraeklgktpedlgreeflelcrelaeeyide
00380301   1/1  aRylrmlGydVlfvpgwDdhGlpiellaeklgiklllriddlgreeflelprelaeeyideikedlkrlg
00433481   1/1  RylrmrGydVlfvpgtDdhGlpielkaekfgetpreladeyidefkedlkrlgisfdw..fyrttdpeyi
00523841   1/1  ylrmlGydvlfvpgtddhGlpielraeklgidpreladeyiaeikedlkrlgisfdw..fyrttdpeyie
00429471   1/1  ylrmlGydVlfvpgwDdhGlpielkaekfgetpreladkyiaefkedlkrlgi..dwdrfyrttdpeyie
00405071   1/1  ylrmlGydVlfvpgiddhGlpiellaeefgelpreladeyieefkedlkrlgisfdwfrptatl...yie
00391711   1/1  ylrmlGydvlfvlgidDtglpievkaeeegileeylgkpltgipdflgdprelaeeyideikedlkalgi
00382631   1/1  ylr..GyfvlriedtD................pereteeyidailedlkwlglswdwsryyqserfdyy.
00474121   1/1  llralGydVlrvngvddaGtqigllaaslllrgleepedlypieylldlyvklkklaedeeleeeagefl
00393221   1/1  a....gydvlflig.Dlhgliidpa.......pkelvrenieeikeqllalgl..dp.............
00356911   1/1  llrflGydVlrvngiddwGtqiellaeslkllglellgeipeisylgeyyveiakelielgkdytldpel
00375671   1/1  ----------------------------------------------------------------------
00384021   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00482751   1/1  y.cG..ptPtgplHlGhartal...vlarflr.aGydvlflig.Dahgliid.pagelg.lprelveena
00484741   1/2  ylr..GydvlridDtD................perlteeyidailedlkalg..idwdeevrtqserl.d
00392271   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00395701   1/1  fqra.ghevlvliG.datgrigDpdgkiieralltlelvdenieyikklla.kgldydgpekvtivnnsd
00384011   1/1  ----------------------------------------------------------------------
00433471   1/1  ----------------------------------------------------------------------
00375661   1/1  ----------------------------------------------------------------------
00469541   1/1  ----------------------------------------------------------------------
00471142   2/2  ----------------------------------------------------------------------
00471141   1/2  ekelfklleggpvrvycGidPTgdslHlGh...lvtadvlrrflra.gydvillig.Dltgliddpigkr
00484742   2/2  ----------------------------------------------------------------------
00523831   1/1  ----------------------------------------------------------------------
00533121   1/2  lfkllekgpvrvycGidPTgdslHlGhlr..al.dvl.rylqdagydvilliadlt--------------
00533122   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           WNQWLFLKMLEKGIAYRKTGTVNWDPVDQTVLANEQVIDGRGWRSGAVVEKREIPMYYLRITDYAQELLG
00384031   1/1  avqeiflklyekGliyrgerpvnycpsdetaladaeveypvcwrskgdpvelrlteqwflklskladrll
00390711   1/1  lgisfdwsrfyrTtdpeyieavqelflkllekgliyrgegpvnydpsdetaladaeveggeypvcwrsgt
00375681   1/1  ikedlkrlgisfdwdrfyaTtdpeyieavqelflkLyekGliyrgdgpvyycpscetaladrevegypvc
00380301   1/1  isfdwfrpyattdpeyieavqevflkllekGliyrgerpvyydpscetaladaev.epvcwrsgtpvevr
00433481   1/1  eavqeiflklyekgliyrgegpvnycpscetaladae.....cwrsgtpvevrlteqwflklgklkdrll
00523841   1/1  avqeiflkLlekGliyrgegpvyycpscetaladlevedpvcwrsgapvevrlteqwflklsklkdklle
00429471   1/1  avqeiflkllekgliyrgegpvyydpsdetaladle.....cwrsgtpvelrateqwflklgkladrlle
00405071   1/1  avqelflkllekglayegdgavyydplekegdlgdlelikldgpvcyrsgdpvelkltpqwfvl......
00391711   1/1  dpdwvsesslyksglykeiitrqseyieliqeilekllekglayekdgtvnflprcktalgdlsvevkk.
00382631   1/1  ..qelflkLlekGlayrcfctvewlpalrtalaeagvepkyrgrsrelnlelviattrpetlegdyalrl
00474121   1/1  lrledgdpkrladesieeikedlkrLgv..dfdryvresesyysgavqeviekLlekGlayekellvndg
00393221   1/1  ......................................................................
00356911   1/1  eelareffrkleegdeeylklwqklvdrsleefkedlkrlgvkfdvyrgestlyidgiievvelleekgl
00375671   1/1  ----------------------------------------------------------------------
00384021   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00482751   1/1  aailedlkalgi..dpdkfiitaqseileiv.eliekLlekglayealnrmvyfd...............
00484741   1/2  ayqelfekllekGlayvcelsveflvelnlfyygrlsngevpe...........................
00392271   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00395701   1/1  wlsklnlidflrdlgkhvsv..................................................
00384011   1/1  ----------------------------------------------------------------------
00433471   1/1  ----------------------------------------------------------------------
00375661   1/1  ----------------------------------------------------------------------
00469541   1/1  ----------------------------------------------------------------------
00471142   2/2  ----------------------------------------------------------------------
00471141   1/2  atrvg-----------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00523831   1/1  ----------------------------------------------------------------------
00533121   1/2  ----------------------------------------------------------------------
00533122   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DLEGLGWPERVKIMQQNWIGRSEGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAAEHPL
00384031   1/1  ealeelewrpevvrkrlewile................................................
00390711   1/1  pvevrlteqwflklgkladrllealesgewippevvrkr...............................
00375681   1/1  wrsgapvevrlteqwflklsklddrllkalkkgefvpeevknrlrnwlen....................
00380301   1/1  lteqwflklgkladrllealeegervivpeevknrldnwleg............................
00433481   1/1  ealeklewpesvknrllnwle.................................................
00523841   1/1  kldpldfalwpesvkgellnwleng.............................................
00429471   1/1  aleegewpeevrnrldnwlekg................................................
00405071   1/1  ......................................................................
00391711   1/1  ......................................................................
00382631   1/1  ......................................................................
00474121   1/1  avlfrlekfgddgeledrvllksdGtp...........................................
00393221   1/1  ......................................................................
00356911   1/1  lyesdgavyfdltkfgd.....................................................
00375671   1/1  -----------------wegkspgvyvkfpll..dslllllkdvylvvwTTrPeTlpgntavavnpeley
00384021   1/1  --------------------ksegvyvkfplvd........gdeylvvwTtrPeTlpgntavavnpehey
00498691   1/1  ----------------------egiyvkfp..lvdglllllgdvylvvwTTrPeTlpgntavavnpeley
00482751   1/1  ......................................................................
00484741   1/2  .leavlrllvdlgklvprdlvlgalwi.dlp..gdeddwvivwgdglpgY....dlavvvddallgidiv
00392271   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00395701   1/1  ......................................................................
00384011   1/1  ----------------------------------------------------------------------
00433471   1/1  ----------------------------------------------------------------------
00375661   1/1  ----------------------------------------------------------------------
00469541   1/1  ----------------------------------------------------------------------
00471142   2/2  ----------------------------------------------------------------------
00471141   1/2  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00523831   1/1  ----------------------------------------------------------------------
00533121   1/2  ----------------------------------------------------------------------
00533122   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           ATHAAESNPALAAFIEECKHGSVMEADMATMEKKGMPTGLKVTHPLTGEQVDVWVGNYVLMTYGDGAVMG
00384031   1/1  ......................................................................
00390711   1/1  ......................................................................
00375681   1/1  ......................................................................
00380301   1/1  ......................................................................
00433481   1/1  ......................................................................
00523841   1/1  ......................................................................
00429471   1/1  ......................................................................
00405071   1/1  ......................................................................
00391711   1/1  ......................................................................
00382631   1/1  ......................................................................
00474121   1/1  ......................................................................
00393221   1/1  ......................................................................
00356911   1/1  ......................................................................
00375671   1/1  vlvlvsgellilaeellefllkllglellelevlatlkggvltgllvihPltgreipvlladyVlldyGT
00384021   1/1  vlvlaegellilaealleellkklllelevlatlkggvltglyvihPltgrevpvlladyVlldyGTGaV
00498691   1/1  vlvlv.dgellilaeellekllkkelevlatlkggvltgltvihPldlltgrevpvlladyVlldyGTGa
00482751   1/1  ......................................................................
00484741   1/2  vrG-------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00395701   1/1  ......................................................................
00384011   1/1  ----------------------------------------------------------------------
00433471   1/1  ----------------------------------------------------------------------
00375661   1/1  ----------------------------------------------------------------------
00469541   1/1  --------------------------------------GklvilPlvgreipiiadeyvdlefGtGavki
00471142   2/2  ----------------------------------------------------------------------
00471141   1/2  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00523831   1/1  ----------------------------------------------------------------------
00533121   1/2  ----------------------------------------------------------------------
00533122   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VPAHDERDFAFALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHGLCIHSGKYDGLGYKAAVDAIAADLA
00384031   1/1  ......................................................................
00390711   1/1  ......................................................................
00375681   1/1  ......................................................................
00380301   1/1  ......................................................................
00433481   1/1  ......................................................................
00523841   1/1  ......................................................................
00429471   1/1  ......................................................................
00405071   1/1  ......................................................................
00391711   1/1  ......................................................................
00382631   1/1  ......................................................................
00474121   1/1  ......................................................................
00393221   1/1  ......................................................................
00356911   1/1  ......................................................................
00375671   1/1  GaVhiaPahdedDyevakkyglpiinvvd..................edGvltnesgefaGldvfeArka
00384021   1/1  mivPahdedDyefakkyglpiinvidddgl...lleealelayleegllinsgefaGldvfeArkaiiel
00498691   1/1  VhtaPahgedDyevakkyglpiinvvd...................dgglfnsgefaGldvleAnkaiie
00482751   1/1  ......................................................................
00484741   1/2  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00395701   1/1  ......................................................................
00384011   1/1  ----------------------------------------------------------------------
00433471   1/1  ----------------------------------------------------------------------
00375661   1/1  ----------------------------------------------------------------------
00469541   1/1  tpahdfnDyevgkrhnlplinvldedgtl...............nenllageyegldrfearkkivelle
00471142   2/2  ----------------------------------------------------------------------
00471141   1/2  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00523831   1/1  ----------------------------------------------------------------------
00533121   1/2  ----------------------------------------------------------------------
00533122   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           AKGLGEKKVTWRLRDWGISRQRYWGTPIPLIHCDSCGVVPVPEKDLPVVLPEDLVPDGTGNPLAKDPRFL
00384031   1/1  ............glrdwciSRqrywGvpiPvwycescliesvydellpvvlgeleeggllleadgdllsl
00390711   1/1  ..............................llnwleglrdwciSRqryWGvpiPiwycedlgdvvvieav
00375681   1/1  .........................................lrDwcisRqrpWGvpiPvwhiedgaivyv
00380301   1/1  .................................lrdwcisRqrywGvpiPgwhiedgamvvvllgdgavl
00433481   1/1  ...........nglrdwciSRqrywGvpipvwiekddgkviyvwfdalvgyp..................
00523841   1/1  ...............lrdwcisRqswdrywGvpiPgw.................................
00429471   1/1  ............lkdwcisrqrlywGvpiPgw......................................
00405071   1/1  .............lkglkdwaisRqrpwGvpiPgwhi.................................
00391711   1/1  ...................................................wgdgiplykak........
00382631   1/1  ....kidlesglenlrDwvisrqrywghdipllrs...................................
00474121   1/1  ..........................................................tyllrDlaisrq
00393221   1/1  .............ekwtifrqsdwgeyiellldlgklt................................
00356911   1/1  ................................dlrdwvisrs............................
00375671   1/1  iielLeekglllkle-------------------------------------------------------
00384021   1/1  Leekglllhsy-----------------------------------------------------------
00498691   1/1  lLeelglllk------------------------------------------------------------
00482751   1/1  ......................................................................
00484741   1/2  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00395701   1/1  ......................................................................
00384011   1/1  ----------------------------------------------------------------------
00433471   1/1  ----------------------------------------------------------------------
00375661   1/1  ----------------------------------------------------------------------
00469541   1/1  elgllvkvedlklsvg------------------------------------------------------
00471142   2/2  ----------------------------------------------------------------------
00471141   1/2  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00523831   1/1  ----------------------------------------------------------------------
00533121   1/2  ----------------------------------------------------------------------
00533122   2/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           ECTCPSCGKPARRETDTMDTFIDSCWYYMRYTCPDAGTMVDARNDYWMPMDQYIGGIEHAILHLLYARFW
00384031   1/1  lgdlkdfvllksdgpleretdvldvWfdSgwgylrvlgyptedlayileklerwfpvdiyvgGkDhirfH
00390711   1/1  lelvdpldfvlwksddlgeplwdlv.vlcpkcglelkrdtdvldvWfdSglgylgrlgwpie..csamfe
00375681   1/1  aediaylllkaieggtdllltlelldllvlyyvllgklglelkretdvldvWfdSglyylavlgyp....
00380301   1/1  lpt...................ytfgddgdlvlresdvldtwfdsglyylstl..dlavdkekfe.llfp
00433481   1/1  ..tglgrpgekleretdvldtwfdsg.....................wypadihvgGkDiirfhllyspa
00523841   1/1  ...................etdvldvWfdsslmylaylgaple....dlfelwwpadihvgGkDliffhl
00429471   1/1  ..............ekdvldvwfdsgiyyieclaapllklgdkedfekwwpadgvdelihvgGkDliffh
00405071   1/1  ...................dvldvwfdsl.....................glpvdihvgGkDliffhlly
00391711   1/1  ...........................................diadvwfdspwgygrpgyplecaadd.
00382631   1/1  .................dglptyflavvvd................dallgithvlrGaDhlfntlryil
00474121   1/1  rfwghpipgwespwg.................................................dvlptw
00393221   1/1  ......tvgellrrddvkdrw.dssisfgllgYp....llqaadilllgvdivpgGkDqwphhelgreia
00356911   1/1  ....................................dggytYftsdiayaly..........rferlgfd
00375671   1/1  ----------------------------------------------------------------------
00384021   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00482751   1/1  .............................................dvvdvwfdg.wsiglf.ypllqaa.
00484741   1/2  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00395701   1/1  ....................nrmlarddfalrl...edgislgeflYpllqayDflhlecgygvdlqigG
00384011   1/1  ----------------------------------------------------------------------
00433471   1/1  ----------------------------------------------------------------------
00375661   1/1  ----------------------------------------------------------------------
00469541   1/1  ----------------------------------------------------------------------
00471142   2/2  -----------------------------------------aadilhlgadivlgGkDq.fphhelgral
00471141   1/2  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00523831   1/1  ----------------------------------------------------------------------
00533121   1/2  ----------------------------------------------------------------------
00533122   2/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           TKVMRDMGLVKFDEPFTNLLTQGMVLNETFYREDASGKKTWYNPADVDVQTDERGRPAGATAKADGQPVV
00384031   1/1  flyllavlralgdlglltgkePfknvlthGlvldellltlllctleflrgrelygyvlrllallkalgle
00390711   1/1  kylpvdihvgGkDiirfhllyslalllalfg......kpppknvlvhglvldldg...............
00375681   1/1  ....felgypadihvgGkDiiffhfarllaaslalfg......kpppknvlhhglvldldg.........
00380301   1/1  vdiyvgGkDliffhflrllailealgg......kapfkevlhhglvldldg...................
00433481   1/1  illaarmlgllleltgleppknvlvhgfvlldg.....................................
00523841   1/1  lrlialllalgg.......epfknvlvhglvldldg..................................
00429471   1/1  llyslaillal.gl......eppknvllhgfvlldg..................................
00405071   1/1  eiailealfg......leppkyvlhhgfldldg.....................................
00391711   1/1  ...lllgvdivlgGkDhifphllylpaqrealealg....leppkvllyhgvvlgldg............
00382631   1/1  lleal.........glpfpkvlhhglvldldg......................................
00474121   1/1  fiellayvv.............ddlgfdvdiyvvGadhi.lhferlrailealgllpla....pppehlh
00393221   1/1  r.............pfpvllthplll...........................................g
00356911   1/1  kdiyvvgadq....llhfaqlfaalaalgy....epakkvlhvgfvl.......................
00375671   1/1  ----------------------------------------------------------------------
00384021   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00482751   1/1  ...dilllgadivlgGkDq.ffhlelgralaralg........lpfpevlthpl................
00484741   1/2  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00395701   1/1  sDq.fpnillgrdllrallgl.......pkpvglttplllgldG.e........................
00384011   1/1  ----------------------------------------------------------------------
00433471   1/1  ----------------------------------------------------------------------
00375661   1/1  ----------------------------------------------------------------------
00469541   1/1  ----------------------------------------------------------------------
00471142   2/2  aral................................................ggkppyvlhhp....lll
00471141   1/2  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00523831   1/1  ----------------------------------------------------------------------
00533121   1/2  ----------------------------------------------------------------------
00533122   2/2  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           IGGIEKMSKSKNNGIDPQALIDQYGADTARLFVMFAAPPEQQLEWSGSGVEGASRFLRRVWNYGYANAQA
00384031   1/1  ldglplplyhlvfgflnldg.eKMSKSkGnvvtpddlldeygadalRyfllfsgp---------------
00390711   1/1  ..............................eKMSKSlgnvidpldllekygaDalR--------------
00375681   1/1  ....................................eKMSKSlGnvidprdlleky--------------
00380301   1/1  ..........................eKMSKSlGnvvtpddllekygadalRlfll--------------
00433481   1/1  ........eKMSKSlgnvidpldlldkygadalRlyllslapygsdldfseeilvgav------------
00523841   1/1  ..........eKMSKSlgnvvdprdllegygadalRlyllslapygsdldfseellv-------------
00429471   1/1  ...........eKMSKSlGnvitpddllekygadalRlfllsalapygsdldfseellvg..r-------
00405071   1/1  ........eKMSKSlGnvitprdlleeygadalRlflls.asyrsdldfseelllg--------------
00391711   1/1  ................................eKMSKSkGnvitldd-----------------------
00382631   1/1  ......ekmSKskgnvvvpldlidgygdprlptlaglrrrGyladalrlflallgpsksdlnf-------
00474121   1/1  fglvlld...........................................gk..----------------
00393221   1/1  ldGveKMSKSkgnvitlddlleeiakkikkaftdprevygadalryfllsglp.dkdvvfllelltelsl
00356911   1/1  .....................v.g..kMSkrkGnvvtlddlleeygadalrlflls.kspds--------
00375671   1/1  ----------------------------------------------------------------------
00384021   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00482751   1/1  ...........................llgldG.eKMSKSlgnsvitlldlleeygadilryfllsgnyr
00484741   1/2  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------ynklwnaarFllrnldgfdp....
00390691   1/1  ---------------------------------------------fynklwnalrFllrnlnlfdklldg
00395701   1/1  ...................KMSKSlgnaiwlddllksiykkiqkalnvyd--------------------
00384011   1/1  -------------------------------------------------------Flnklwnlvrfllen
00433471   1/1  -------------------------------------------------anklgNllnRtlrfilknldg
00375661   1/1  -----------------------------------------------------ynklwnalrFllgnldd
00469541   1/1  ----------------------------------------------------------------------
00471142   2/2  gldGteKMSKSlgnaitlddllekigpkilryydalls.thyrlpldfsleellelldlllrlknarlaq
00471141   1/2  ----------------------------------------------------------------------
00484742   2/2  ----eKmSK..Gn.vtl..lldegygpdalryfllr.lgyssdldfslealeeavnlafklgnlak----
00523831   1/1  ------------------------------------------------LandlgNlvnRvlsfiakyfdg
00533121   1/2  ----------------------------------------------------------------------
00533122   2/2  ldG.eKMSKSlgnaitldd..ektipekirkallssg............drdvlnllklllflaleeler


                         -         -         -         -         +         -         -:770
query           IRDGAGTAPTADDAALRREIHTVLKQANYDYERIQYNTVVSATMKMLNALEDAKTASPAGRREGFSVLLR
00384031   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00375681   1/1  ----------------------------------------------------------------------
00380301   1/1  ----------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------
00523841   1/1  ----------------------------------------------------------------------
00429471   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00391711   1/1  ----------------------------------------------------------------------
00382631   1/1  ----------------------------------------------------------------------
00474121   1/1  ----------------------------------------------------------------------
00393221   1/1  deleelenayrs........gelnpgdlkka---------------------------------------
00356911   1/1  ----------------------------------------------------------------------
00375671   1/1  ----------------------------------------------------------------------
00384021   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00482751   1/1  dddvldfselilflaldllnklrnalrfgplllealeelaeeyts-------------------------
00484741   1/2  ----------------------------------------------------------------------
00392271   1/1  ....dleelslldrwilsrlnelikevteayekyrfntalsalyefvwndlsdwYlelikprlyae..dr
00390691   1/1  alp..leelslldrwilsrlnelikevteayenyrfntavaalyefvnddlsnwYlelikdrlygeadse
00395701   1/1  ----------------------------------------------------------------------
00384011   1/1  ldgfdplldleelslldrwllsklnetikkvtealekyrfntaisalmefvnalsdwylelakdrvllea
00433471   1/1  fvp.dleelteldrwllsrlnelikevteayenyefnkalraimelvnlanwYldlskpwllake.dser
00375661   1/1  fdpeedlldveelsllDrwilsrlnelikevteayenyefntalsalynfvwndlsdwYleliKdrlygd
00469541   1/1  ----------------------------------------------------------------------
00471142   2/2  lrlayelgklvhgelkaalaellnellaplrellee----------------------------------
00471141   1/2  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00523831   1/1  vvp......teadkellalllelleevaeameklefrkaleeimelarlaNkyidetePWklakedperl
00533121   1/2  ----------------------------------------------------------------------
00533122   2/2  lraeylggkgpgeakkllaeeltellhpideareale...------------------------------


                         -         -         *         -         -         -         -:840
query           VLYPVVPHIAHGLWQELGYAAETVDILDAAWPQVDEAALVRSEIELVLQVNGKVRGSLTVPADADRAAIE
00384031   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00375681   1/1  ----------------------------------------------------------------------
00380301   1/1  ----------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------
00523841   1/1  ----------------------------------------------------------------------
00429471   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00391711   1/1  ----------------------------------------------------------------------
00382631   1/1  ----------------------------------------------------------------------
00474121   1/1  ----------------------------------------------------------------------
00393221   1/1  ----------------------------------------------------------------------
00356911   1/1  ----------------------------------------------------------------------
00375671   1/1  ----------------------------------------------------------------------
00384021   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00482751   1/1  ----------------------------------------------------------------------
00484741   1/2  ----------------------------------------------------------------------
00392271   1/1  saqtvlyevletllrllaPflPfiaeelwqrlgg..ee.svhladwpevdeldelleeevelvvqvigkl
00390691   1/1  arraaltvlyevletllrllaPflPfiaeelWqrlplllglggeesvhlaswPevdealld---------
00395701   1/1  ----------------------------------------------------------------------
00384011   1/1  letllrllaPfaPhiaeelWqllgg....gsvllapwPevd-----------------------------
00433471   1/1  lravlyvllevlrillillaPflPfiaeeiwqqlglee...svhlaswplldghkigkpeplferledee
00375661   1/1  aadsaarrsaqtvlyevletllrllaPflPfiaEeiWqrlpgleee.svhladwpevdelaelideelee
00469541   1/1  ----------------------------------------------------------------------
00471142   2/2  ----------------------------------------------------------------------
00471141   1/2  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00523831   1/1  atvlylllellrllaillaPflPelaekildqLgldeevrlldwlelgll--------------------
00533121   1/2  ----------------------------------------------------------------------
00533122   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           ATAAASEIVAKFAAGAAPKKIVVVPGRLVNVVL-------------------------------------
00384031   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00375681   1/1  ----------------------------------------------------------------------
00380301   1/1  ----------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------
00523841   1/1  ----------------------------------------------------------------------
00429471   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00391711   1/1  ----------------------------------------------------------------------
00382631   1/1  ----------------------------------------------------------------------
00474121   1/1  ----------------------------------------------------------------------
00393221   1/1  ----------------------------------------------------------------------
00356911   1/1  ----------------------------------------------------------------------
00375671   1/1  ----------------------------------------------------------------------
00384021   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00482751   1/1  ----------------------------------------------------------------------
00484741   1/2  ----------------------------------------------------------------------
00392271   1/1  rslraelnipkslplevliaaad..ellkklld-------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00395701   1/1  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00433471   1/1  leelieqlkgliravrkareeanieklikl.---------------------------------------
00375661   1/1  lmelvrevikairslrkeknikpslplkvtiy--------------------------------------
00469541   1/1  ----------------------------------------------------------------------
00471142   2/2  ----------------------------------------------------------------------
00471141   1/2  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00523831   1/1  ----------------------------------------------------------------------
00533121   1/2  ----------------------------------------------------------------------
00533122   2/2  ----------------------------------------------------------------------