[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for rmet0:ABF09882.1


[Show Plain Result]

## Summary of Sequence Search
   1::302
  16::285  2.8e-15 23.3% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  16::285    1e-13 21.5% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  13::217  2.2e-11 23.3% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
  23::285  2.8e-11 24.7% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
  26::287  7.3e-11 24.5% 0047420 00474201 1/1   p containing nucleoside triphosphate hy 
  23::274  8.6e-11 22.7% 0049491 00494911 1/1   p containing nucleoside triphosphate hy 
  21::285  3.3e-09 21.1% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  13::277  3.9e-09 22.3% 0049053 00490531 1/1   p containing nucleoside triphosphate hy 
  26::285  9.8e-09 23.1% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
  31::285  3.3e-08 25.1% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
  20::282  5.9e-08 19.7% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  21::282  7.8e-08 20.4% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
  28::285  1.1e-07 25.2% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
  27::285  2.2e-07 22.1% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
  20::298  3.1e-07 21.1% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
  26::285  4.5e-07 22.0% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
  22::283  1.8e-06 23.3% 0047665 00476651 1/1   p containing nucleoside triphosphate hy 
  21::272  3.5e-06 25.0% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
  24::280  6.3e-06 17.9% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
  21::226  6.8e-06 25.4% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
  26::262  6.8e-06 19.1% 0046258 00462581 1/1   p containing nucleoside triphosphate hy 
  31::190  7.6e-06 22.6% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
  23::285  9.6e-06 25.9% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
  62::215  3.8e-05 17.0% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
  28::302    4e-05 20.6% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
  25::268  4.6e-05 22.9% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
  34::205  5.2e-05 23.3% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
  13::279  0.00015 20.4% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
  58::184  0.00017 22.8% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
  22::182  0.00056 28.6% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
   1::302


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEEYPIIDLSHLLPAAQGLARLPADERIHRLRADRWIGYPRAVEALNRLEILYTWPNKQRMPNLLLVGPT
00503741   1/1  ---------------fifldlrplallplp...drlvgrdeeiealskalgg..aldgvslsiepggivl
00402371   1/1  ---------------vlektgipltkllrpvllddviGqeealeallealrr......rpgrnvllvGpp
00394721   1/1  ------------lvslleslelplleklrpvllddvvgreealeallealrr......gpprnvlLvGpp
00521551   1/1  ----------------------plveklrpvllddvigqeeakeallealarlkapelflslglrpgkgv
00474201   1/1  -------------------------deelelleklslllveklrpvllddlvgqeeakeallealr....
00494911   1/1  ----------------------llveklrpvllddlvgqeeakealleala......agrpghvllvGpp
00437901   1/1  --------------------slllvekyrpvllddvvgqeeakeallealalararplkrpelflslgir
00490531   1/1  ------------tlpaleseardltekarpvlldd.viGqeeaierl..lealerg....ppgnvLlvGp
00392701   1/1  -------------------------eklrpvllddvvgqeeakeallealagarlaledlslgirpgknv
00367291   1/1  ------------------------------vtlddvvgqeeakeallealelalkgldlflslglrpgrn
00437921   1/1  -------------------lglllveklrpkllddvvgqeealerlllalk......agklphlllvGpp
00437941   1/1  --------------------lrplveklrpknlddvygqeevlkalslale......kgrpehlllvGpp
00420941   1/1  ---------------------------lrpvllddvigqeeakeallealalplkrldlglslgirpgkg
00386741   1/1  --------------------------klrpvllddvvgqeeakeallealkavll.girpgehllLvGpp
00368501   1/1  -------------------kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgk
00473941   1/1  -------------------------eklrpvllddvvgqeevkkalllalalallrge.pgehvlLvGpp
00476651   1/1  ---------------------yeplveklrpvllddlvgqeeakealleala......ggrpprpvllvG
00418301   1/1  --------------------drplleklrpvllddviGqeeakkallealalplkrlelfeklrgirpgk
00437981   1/1  -----------------------lveklrpknldkvigqeealkdlslalk......pgeiphalllvGp
00379261   1/1  --------------------drllleelrpvllddviGqeeakealsealrlplkrlelferlglrrpgk
00462581   1/1  -------------------------edleslllnplvkfedivpkvlddleealealaea.klp...ppk
00470731   1/1  ------------------------------arpltfddvvgqdeakeeleel..lagllgikkpkvillv
00406781   1/1  ----------------------plveklrpvllddvigqeeakeallealaglrlllkdlslgippgknv
00512891   1/1  -------------------------------------------------------------evilltGpp
00379961   1/1  ---------------------------yrpvdfddivGqeealralslalaag......ppegvllvGpp
00404191   1/1  ------------------------vellpkvtlddlvgleelkealkealell.slgikpgeivllyGpp
00527261   1/1  ---------------------------------npfilgpkvdledfigreeelkeleeal.........
00430121   1/1  ------------iPvsklleddrplleklrpvlfddvvgqeeakeallealrrgrkglelgirpggnvll
00482551   1/1  ---------------------------------------------------------everlstgipalD
00482661   1/1  ---------------------kkvaivllsnyalsislddlllildlykevqvaydnfykvdesdiayqy


                         -         -         *         -         -         -         -:140
query           NNGKSMIVEKFRRTHPARADADQEHIPVLVVQMPSEPSVIRFYVALLAAMGAPLRPRPRLPEMEQLALAL
00503741   1/1  lvGppGvGKTtLakllagllkpkfgeillfgkvvyvnvselldlkellrlllealglpppyq.lsggerl
00402371   1/1  GvGKTtlaralagllvrssgpilldgvpfvrldaselle..............fgkyvgafegglrqllg
00394721   1/1  GvGKTtlakalakelaag.....sgpilldgvpvvrldlsellsv..............sdlvgeleggl
00521551   1/1  lLvGppGtGKTtlaralagll.........gapfvrlsaselvg................kyvgeleggl
00474201   1/1  ..agrpghvllvGppGtGKTtlaralanelprs....lpglpfvrvnasdltd.....vglleellgkll
00494911   1/1  GtGKTtlaralanellrlgvl...glpfvrvnasellealllsdlfgellgallralfellrgalela..
00437901   1/1  pgrillLyGppGvGKTtlakalakel.........gapvieidaselrd...........vddlsgyvge
00490531   1/1  pGtGKTtlaralakelargd.............vpevlvgvpvieinassllfGskyvgefeealrrlfg
00392701   1/1  lLvGppGvGKTtlaralagll.........gapfgrvdasdllg................kyvgelsggl
00367291   1/1  vllyGppGtGKTtlaralanel.........gapfirvdaselleklvg................egegr
00437921   1/1  GvGKTtlaralarlllgs....gggvdvieldasdlrgvddlreligevlqalglllgg...........
00437941   1/1  GtGKTtlakalaglllptsg....gvrvlgidaselld................pselsggerqrvliar
00420941   1/1  vllyGppGtGKTtlakalagel.........gapfiridgsellg................kyvgelsgg
00386741   1/1  GtGKTtlaralagel.........gapfvrldaselsg......................geklrgllar
00368501   1/1  nvlLvGppGvGKTtlaralakll.........gapfiridgseltekdyvGesvearlrelfeeaigyvf
00473941   1/1  GtGKTtlaralagllga.........pfielsasdllg..................esdlrggfkqa...
00476651   1/1  ppGtGKTtlaralanelgrpfvpvallcfvrvncaallelsasdll............eselfgeekeaf
00418301   1/1  nvlLvGppGtGKTtlaralakll.........grpfirvdaselteaelvGy...........esgarlr
00437981   1/1  pGsGKttlaralagllgpdsgkilldgkdi...rrgiglvfqliglfphltvlelvalglggilveevre
00379261   1/1  nvlLvGppGvGKTtlaralAkll.........gapfvevdaselteggyvgedlekrirelfqearllvf
00462581   1/1  gvllyGppGtGKTtlaralakel.........glpfvrinasd...............llvgllvgeleg
00470731   1/1  GppGsGKTTlaralakel.........gagfilidg...ddlrekavgeleklgrdlfqvareg......
00406781   1/1  llvGppGtGKTtlakalagel.........gvpfvrisase..........llg......kyvgelsggl
00512891   1/1  GvGKTTlakalagel......gakfgsvsltgrdvrsarrgigyvfqtveellgllaelvglevrgelee
00379961   1/1  GtGKstlaralagllppdsg.....rivlvgnlsdlldpkdlrellragiplvflnfaalpasllesell
00404191   1/1  GtGKTtlakalanelkkr......ggrvlyvsa......................delvsklsgglqeqr
00527261   1/1  p.kivlltGprGsGKTtllkalakel.........gkpviyidlselsskgyvdleellrelaeelgell
00430121   1/1  vGPpGvGKTtlakalagllfp......sgvpfirinlseltekllvselighppgyvGede.........
00482551   1/1  ellgGglppgslvliaGppGsGKTtlalqlaanaalplelgklggkvlyisteeafsperlreralslgl
00482661   1/1  allakedenaaaflksnrqkklvrdladrviaeerlellekiieellrirldklledldeiveelppvlf


                         +         -         -         -         -         *         -:210
query           LRKVGVRMLVIDELHNVLAGNSVNRREFLNLLRFLGNELRIPLVGVGTRDAYLAIRSDDQLENRFEPMML
00503741   1/1  rvalaeallalgkpdllilDEitnlldpetl.spdvlelLlrlleegkltdkllgltlilt.thdldlle
00402371   1/1  laraakpgvlflDEidsllgarg.gsgvdpevqnaLlrlleegnvrviaatnrpelvklgeldpallrRf
00394721   1/1  rglltealalakpsvlflDEidrlldardsesslevlnaLlrlledgnvlviattnrpellgrleldpal
00521551   1/1  rqllalaraanpgvlflDEidklapkrsptsglddvsrrrvlnaLlrllegledlsnvlviaatnrpe..
00474201   1/1  gaat...........fllakpgvlflDEidkl.......dpdvqnaLlrlleelpsnvrviattnrpl..
00494911   1/1  ........kggvlflDEidrl.......spdvqnaLlrlleelpsnvrviattnrpel....ldpallsR
00437901   1/1  lsggeklrellaealteavlkgkpsvlllDEidal...dpdvlnallklldglrdlsgvliilttndpe.
00490531   1/1  eaekanggviLflDEidklagarg.sggspdvqnaLlrllergnvrvIaatnrpellkfeldpallrRfl
00392701   1/1  rqrlarallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgvtviattnrpe..
00367291   1/1  lrgalaealradpgvlflDEidalagkrgsgtsrld.pevqnaLlrlleelrvlsgvlviattnrpeel.
00437921   1/1  ....kpdvlllDEidrl...dpdaqnallklleel..pagvtlilttnrle....ellpallsrfdiief
00437941   1/1  alladpkvlllDEidal...dpeaqnaLlklleel.pk.gvtvilttnrlee....ldpallsRfdvief
00420941   1/1  lrqllalaraakpsilllDEidklapkrsptsaldadvrrevlnaLlrlldglqalsnvtviattnrpee
00386741   1/1  ala.kpgvlllDEida.l..dpdvqeallelleegeltivgggllteldglllpsgvlviattnrpel..
00368501   1/1  qdpalfpgtvlenlalgllvseligappgyvggdlggllteavlealriklvegelgfrelerevlldlp
00473941   1/1  ...akpgvlflDEidrl.......drevqnaLlelleelqvtilggglvvvelllllpsgvlviaatnrp
00476651   1/1  lgallerlgklalagggtvlflDEidkl.......dpdvqnaLlrlleeppsnvrvilttnrpekl....
00418301   1/1  elfaragigllaladpgvlflDEidkllpargssggdvsredvlnaLlrlleegeltilgggvdlpnvlv
00437981   1/1  llkellsgGqkqrvaiaralagdpkvlllDEpt.al..dpdaqnaLlklleelak..gvtvilathdls.
00379261   1/1  ltvlenirldaseylekrvvsrligappgyvgyglggllteavrrlpysvllldelekahrpirvlllsa
00462581   1/1  rlrglfteavlanpgvlflDEidrlplkrqaggdllrallealltlldglislp.snvrviaatnrpee.
00470731   1/1  .......glvpdilfideidallrkgpdvildgagrtpeqlealldllee--------------------
00406781   1/1  rqrlalaraadpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrllsgvtviattn.dle.
00512891   1/1  llktlikelsggekqrvalarallakpdvlllDEidgl.......dpdvleallelleelkrsgvtvilt
00379961   1/1  sggerqrvalaralalrpGllvlAdggvlllDEp.dal..dpevqaaLlrlleegevtieragitlllpa
00404191   1/1  vaiafalark..pdllllDEidal.gldpelqeellelldelaer.gvtlilttnnrpeeldqallrlls
00527261   1/1  ellkkllkklsellglsilglelilglsggdleelleelaellkklgkpvililDEiqsll...d-----
00430121   1/1  lgvlfeaarkappsvlllDEidkl.......dpdvlnaLlqlleegevtdlggrvvdlsnviviattnpg
00482551   1/1  dleelldrllvidatdlldllellerlrrllsegkvdlvviDsl--------------------------
00482661   1/1  ddlvgqeeakeal..lenlklflkgpellldlglpkgrgllL----------------------------


                         -         -         -         +         -         -         -:280
query           PVWEANHDCCSLLASFAASLPLRRPSSIATLDMARYLLTRSEGTIGELAHLLMAAAIVAVESGEEAINHR
00503741   1/1  rladrllsrfngkgivielpplse.eelleilkkrlfeagvel...vfddealellaelsarivkkcggl
00402371   1/1  dvielplp.dleerleilklllekllkrlglelsdea.lealaelsyglpgarplvrelenlleralala
00394721   1/1  lrrfdvi---------------------------------------------------------------
00521551   1/1  ..eldpallrpgRfdlvielplp.dleerleilkrlleklgle......sdealealaeltegfsardlr
00474201   1/1  eldpallsRflvielppp.dleerleilkllleklglelsd.....ealealaelspgnprellnllera
00494911   1/1  flvielppp.sleerleilkllleklglelsd.....ealealaelspgnprellnlleraall------
00437901   1/1  ...eldpallrRfdiiefppp.deeelleilkrilekeglkldd.....ealealaelsegsprdllnll
00490531   1/1  vielppp.dleerleilklllkklelgegve.lsdealealaelsdgnigarplprdlinlldeaaa---
00392701   1/1  ..eldpallrpgrfdriieldlp.dleerleilkllleklgleldd.....dalellaeteggsardlln
00367291   1/1  ...dpallrpgRfdlvielplp.dleerleilkllleklgls..sdealealaelt...egfsarellnl
00437921   1/1  kpl.seeelleilkrileeegvklsd.....ealealaelsggdpraalnlleraaa.....grelitle
00437941   1/1  ppp.deeelleilklilkkeglk.....lddealellaelsggsprdalnlldraavlaagriveegtpe
00420941   1/1  ....ldpallrpgRfdlviefplp.deeerleilkllleklgle..sdealealae....ltegfsgrdl
00386741   1/1  ..ldpallsRfdlvielppp.deeerleilkrllkkegleldd.....ealealaelaegsprdllnlle
00368501   1/1  lhdasviallgggrelrdgellkalkeaeaeellellglkdlllrkpsqlSgGqkqRvalaralladpgv
00473941   1/1  el....ldpallsRfdlvielppp.dleerleilkrllkkegve.....lddealellaelaggsardll
00476651   1/1  dpallsRflvielppp.sleerleilkllleklglplsd.....ealealaelsggnprellnllerall
00418301   1/1  iaatnpdlyrpdeldpallrRfdlvielplpdleerleilklllerllkrlaallglkklgl--------
00437981   1/1  ...ellpallsrcqvirfpplseee.....lleildrilvleggklvedgaleelaelsggdprkalnll
00379261   1/1  slvlllgglglpevge------------------------------------------------------
00462581   1/1  ...ldpasllrRfdviielplpldleerleilkll..........lelsdea------------------
00470731   1/1  ----------------------------------------------------------------------
00406781   1/1  ..eldpallrpgrfdrvielplp.dleerleilkllleklgle..sdealealaelt...egfsardlrn
00512891   1/1  tndld-----------------------------------------------------------------
00379961   1/1  gvtviaatnddlg...eldpalldRfdlvielgplrdreerleilrhllekearrlgflepvaeslealr
00404191   1/1  rldrvivldlppdleergeilkrlaeklglp.....lsdevlellaert.gngrelin------------
00527261   1/1  ----------------------------------------------------------------------
00430121   1/1  legivellldllllgrlrelvedelrdrldpallrRfdrviefpppdeeelleilrlllkkllkrlalk-
00482551   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           TLSMADYTGPSERRRQFERELM------------------------------------------------
00503741   1/1  rlald-----------------------------------------------------------------
00402371   1/1  llrll-----------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00521551   1/1  nller-----------------------------------------------------------------
00474201   1/1  lllalle---------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437901   1/1  eraal-----------------------------------------------------------------
00490531   1/1  ----------------------------------------------------------------------
00392701   1/1  llera-----------------------------------------------------------------
00367291   1/1  leraa-----------------------------------------------------------------
00437921   1/1  dv--------------------------------------------------------------------
00437941   1/1  dl--------------------------------------------------------------------
00420941   1/1  rnlld-----------------------------------------------------------------
00386741   1/1  raaal-----------------------------------------------------------------
00368501   1/1  lflDEidklldargssgg----------------------------------------------------
00473941   1/1  nller-----------------------------------------------------------------
00476651   1/1  lal-------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00406781   1/1  llera-----------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00379961   1/1  eaillarelllgvplsdealel------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------