[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE37468.1


[Show Plain Result]

## Summary of Sequence Search
   1::89
   7::88   PF00312 0.0% 51.219512195122  Ribosomal protein S15 
   1::89


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSITAERKAEVIQGNANKAGDTGSPEVQVAILSERIVNLTAHFKTHTKDNHSRRGLLKLVSTRRSLLDYV
PF00312         ------akekkiseilkeekdtgsvevqvalLterivrLrkHleehkkDysskrgLiklvskrkrLlaYl


                         -         -         *         -         -         -         -:140
query           KKKDEARYKALLEKHNIRR---------------------------------------------------
PF00312         kkkntakYeelieklglr----------------------------------------------------