[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE37597.1


[Show Plain Result]

## Summary of Sequence Search
   1::426
 186::351  PF00849 0.0% 34.6153846153846  RNA pseudouridylate synthase 
 113::159  PF01479 0.0% 44.6808510638298  S4 domain 
   1::426


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVAGGGGGDDARPLRQPQRGLGGDRNASLGAEKLIADGDENRRERQRRGQARDHHHPPHPRKQRGLFGGR
PF00849         ----------------------------------------------------------------------
PF01479         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FGQGGFGHAMLGFGSVFLEGSIVNDSSGHLLEVVVAGDEGSPRLDRVLATRCPALSRSRLKALILDGRVA
PF00849         ----------------------------------------------------------------------
PF01479         ------------------------------------------RLDkvLarlglassrseArqlIehGhVr


                         +         -         -         -         -         *         -:210
query           IRGAPVRDPAYHAASGETITIDVPPPVAPEPAGEAIALEIVHEDDDIIVIDKPRGLVVHPAAGHETGTLV
PF00849         ---------------------------------------------dlvvvnKPagvpvtpeak...ggse
PF01479         VNGkvvkdpsyrVkpgDvi---------------------------------------------------


                         -         -         -         +         -         -         -:280
query           NALIAHCGESLSGIGGVRRPGIVHRLDKDTTGLMVAAKNDRAHQSLSAQFADHGRTGELRRGYYAFVWGA
PF00849         keksttatssrae...eekkelklvhRLDkaTsGllllAksgeaaaklakaf....eerkvrKkYlalvf
PF01479         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           PNRIRGTIDAPIDRHPHAREKMAVRDGGREAITHWEVLETFTGRSGGEIVSLIACQLETGRTHQIRVHLA
PF00849         gapleeegaikskiskdtekqegarrkkeeldgkkavtylrvlesgsktpksnasakvtlveleletGrk
PF01479         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           HIGHPLLGDDVYGPHFKTKASQLRPDARAALTDLGRQALHAYLLVLEHPSTGEVVAWESGLPADLKRLKA
PF00849         h---------------------------------------------------------------------
PF01479         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           ALTATE----------------------------------------------------------------
PF00849         ----------------------------------------------------------------------
PF01479         ----------------------------------------------------------------------