[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE37664.1


[Show Plain Result]

## Summary of Sequence Search
   1::279
  10::266  PF03618 0.0% 43.921568627451  Domain of unknown function (DUF299) 
   1::279


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLTDGSYFHLHLVSDSTGETLITVSRAVAAQYANVSPVEHVYPLVRSQKQLDRVLQEIEESPGIVLFTLL
PF03618         ---------iflvSdstgetaekvaraalaqFeeveveeerlpfiedeekleevleeikeeeglvvytlv


                         -         -         *         -         -         -         -:140
query           ESELVNRLEAKCQQINSPSLSIIGPVMQLFEAYLGASTTGRVGAQHTLNAEYFKRIDALNYSMMHDDGQH
PF03618         dpelrealkekaeelgvklvdvlepllealeeelgvkpseepgrehkldedYfkrieAiefalkhDDGks


                         +         -         -         -         -         *         -:210
query           VEGLEEADVVLVGVSRTSKTPTSIYLANRGIRTANVPLVAGIPIPHQLETLKKPLVVSLHASPDRLIQVR
PF03618         peeleeAdiiLvGvSRtsKTPlslYLAnkgikvaNvPlvpevelpeelaevdkkkvvgLtidperLaeiR


                         -         -         -         +         -         -         -:280
query           QNRLLSLGAGAGNDSYIDRQAVTDEVLLARKLSAKYGWSLLDVTRRSIEETAAAIMKLLADRQRQRMSE-
PF03618         keRlkslgld..eskYasleqveeEleeaeklfkkegipvidvteksiEEtaakil--------------