[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE37710.1


[Show Plain Result]

## Summary of Sequence Search
   1::137
   2::134  PF01878 0.0% 54.9618320610687  Protein of unknown function DUF55 
   1::137


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHSAKLHMIAMKKGDRAFFYHSNEGKEIIGIAEIIREA
PF01878         -ayWlmksepdefsiddlaaegq..epWdGvrnyqarnnlrkmkvGDlvlfYhsneklpgivgiaeVvse


                         -         -         *         -         -         -         -:140
query           YPDPTDESGKFVCVDLKADKKLKTPVTLVAVKAEPRLAEMALLKYSRLSVQPVTADEWKLICKMGGL---
PF01878         aypdetafdpkekyydkenpkwlrvdvkfveklkrpvtlkelkaepklkdlsllrrksrlsvqp------