[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE37723.1


[Show Plain Result]

## Summary of Sequence Search
   1::194
  66::193  PF02469 0.0% 46.7213114754098  Fasciclin domain 
   1::194


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKRIAYLSAAALSALALTATAMAPANAEDKKMMKSEMSGEKTVMVGGAPMYPSKNIVENAVNSKDHSTL
PF02469         -----------------------------------------------------------------qfstf


                         -         -         *         -         -         -         -:140
query           VAAVKAAGLVKTLEGKGPFTVFAPTNAAFGKLPAGTVDTLVKPESKATLTKILTYHVVPGKLAAADLTDG
PF02469         vdllekaglaeeleeakgdgglTvFaPtneAfaklppdtlaklln..nkkklkaiLkyHvvpekklsssd


                         +         -         -         -         -         *         -:210
query           KKLTTVEGATLTVKRSGDQVMLVDAKGGSSTVTIPNVNQSNGVIHVVDTVLMPS----------------
PF02469         lksgndatttlegaklkvnikankgkmvvvnn....narvveadveatngvih-----------------