[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE37731.1


[Show Plain Result]

## Summary of Sequence Search
   1::344
 139::318  PF02774 0.0% 44.3820224719101  Semialdehyde dehydrogenase, dimerisation domain 
   4::116  PF01118 0.0% 41.0714285714286  Semialdehyde dehydrogenase, NAD binding domain 
 101::179  PF01960 0.0% 30.1369863013699  ArgJ family 
   1::344


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGYKVAVVGATGNVGREMLAILDERKFPADEVVALASRRSIGVEVSYGDKTLKCKALEHYDFSDVDICLM
PF02774         ----------------------------------------------------------------------
PF01118         ---kvaivGatGyvGqellrlLee.hpelelvalvassrsaGkklaeahkaleegkdlvledadeeelke
PF01960         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SAGGAVSKEWSPQIGAQGAVVIDNSSAWRMDPDVPLIVPEVNAAAAAGFTKKNIIANPNCSTAQLVVALK
PF02774         --------------------------------------------------------------------Lk
PF01118         vdivflalpagvskelapklleagvkviDlssafRldddapyglpe------------------------
PF01960         ------------------------------kkDlalivsekpaaaagvfTtnkvkAapvlvskell....


                         +         -         -         -         -         *         -:210
query           PLHDHAKITRVVVSTYQSVSGAGKEGMDELFSQTKAVYTNSELVNKKFPKRIAFNVIPEIDVFMEDGYTK
PF02774         PLldalgelervivatyqavSGaGkkgvreLlkqvaelqrsdeakpgvfgvpiagNlipyidkeedkgep
PF01118         ----------------------------------------------------------------------
PF01960         ..ekkgkaravvvnsgnANavtGeeGledaeemaelvae-------------------------------


                         -         -         -         +         -         -         -:280
query           EEWKMMVETKKILDPAIKLSATCVRVPVFVGHSEAVNIEFENPITADEARDILRRSPGCLVIDKHEPGGY
PF02774         etreelkavaetkkilefte.kvsatcvrVPvlrGhseavtiklklkdveveeveellaaapevkvvvne
PF01118         ----------------------------------------------------------------------
PF01960         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           VTPYEAAGEDATYISRIRTDPTVDNGLVLWCVSDNLRKGAALNAIQIAEVLINRKLITAKKKAA------
PF02774         .eedrPtpaavaggtnsvsVGRirkdemgdeglklvvv--------------------------------
PF01118         ----------------------------------------------------------------------
PF01960         ----------------------------------------------------------------------