[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE37891.1


[Show Plain Result]

## Summary of Sequence Search
   1::519
 128::347  PF00361 0.0% 27.6497695852535  NADH-Ubiquinone/plastoquinone (complex I), various 
  70::106  PF00662 0.0% 24.3243243243243  NADH-Ubiquinone oxidoreductase (complex I), chain 5 
   1::519


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPIHHLPLLAPIALLAVAAVSFANTGLRPKRLPGLAEAAALLALAAALASAAGLIVSGTHVSPVLGLYGA
PF00361         ----------------------------------------------------------------------
PF00662         ---------------------------------------------------------------------i


                         -         -         *         -         -         -         -:140
query           GFSLRLDAVSAVMLLLVSFIGWVVVRYAGTYLDGEARQGPFTGWLCMTLAAVLLLVTAGNLVQLVLCWIA
PF00361         ---------------------------------------------------------ssnllliylgwEl
PF00662         nwsfllDslsliflivvltVsslvhlYSisYMaeDp----------------------------------


                         +         -         -         -         -         *         -:210
query           TSVFLHRLLLFYPDRLPARRAARKKLVTARLGDVALIGSAALLAAAYGTADIGSILQAARLGEGGSLAVG
PF00361         lglpsylligfwgkspesleaslkyflltalgsllLLlgilllylltgslsfeellk...allnsnllll
PF00662         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AAGLLAFAAVLKSAQFPAHGWLTEVMETPTPVSALLHAGVINAGGFLLIRFADVMLLAPAVLAALVMIGG
PF00361         lsllllvallvKlaqaplhlWlpdamegappvsslllaatlviaglylllrllnllessnelsyillilg
PF00662         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           FTAVFGGLVMLTQPAVKTSLAWSTVAQMGFMILECGLALFPVALLHIVAHSLYKAHSFLASGGAVERVAA
PF00361         ilsillgslialsqtdiKkllAySsishmGyvllgilslnsigielaiillithaffkallFllagl---
PF00662         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           IRRPGPVAIPDAGAVGRAFLAALVIYILVGLGFGLTHKSPQVVALGAILIFGVAYMLAQGFADAAPKALT
PF00361         ----------------------------------------------------------------------
PF00662         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LRTAVYAVATSVGYFALQSSATLLTASVLPATPTPGPLEWALIVIALVSFGLIAIVQAMFPLWAYHPAAA
PF00361         ----------------------------------------------------------------------
PF00662         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           GLRVHLSNGFYANAVFDRLVGGWATRNAS-----------------------------------------
PF00361         ----------------------------------------------------------------------
PF00662         ----------------------------------------------------------------------