[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE38048.1


[Show Plain Result]

## Summary of Sequence Search
   1::456
  50::360  PF04107 0.0% 42.8571428571429  Glutamate-cysteine ligase family 2(GCS2) 
   1::456


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MARDQIDMTPLNSRDELVGWIEAGVKPPSEFRIGTEHEKTPFTLEGHHPVPYAGARGIGALLEGMQLLLG
PF04107         -------------------------------------------------lgvEeeflvvdlatgdlr...


                         -         -         *         -         -         -         -:140
query           WEPIMEGPHIIGLHDVTGGGAISLEPGGQFELSGAPLDNVHQTHAELMAHLAQVREVATPLGIGFLGLGM
PF04107         wseiledeaiigls..eggsvvkelpegqvElstapleslaeaaeeisadleelrsvadelGlellglGt


                         +         -         -         -         -         *         -:210
query           TPSWSREDIPVMPKGRYKIMTNYMPKVGSYGLDMMYRTCTVQTNLDFSSEADMVKKLRVSVALQPVATAL
PF04107         hPfalrsedevtpkaryrrmleymdrvGvlgrqmmvaglhvqvnidssseed.VevlrlvrallPvllAl


                         -         -         -         +         -         -         -:280
query           FANSPFTEGKPNGFLSFRSEIWRDTDNARSGMIPWAFEDGMGFERWVDYALDVPMYFVKRGDHYIDVSGS
PF04107         sAnSPfleGrdtgyaStRariftqtpq..agelplafedgaaferyaryaldvpvidvrr..........


                         -         *         -         -         -         -         +:350
query           SFRDFFDGKNEKLPGERPTLSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFWVGLLYDDTSL
PF04107         ..rlwldirpsslpg....tlelrihdttlfPevrlrallearlldaqpadrldalpaavlvalldleae


                         -         -         -         -         *         -         -:420
query           DAAWEIVKGWDASERQALRDDVPRLGFKARIGNRFLFEIARECLVLAHAGLRRRGRIDGFGHDETRHLAA
PF04107         enawdavrsg------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LDQILDAGRTPAEEMLEKFDGAWRGSVEPAYDEYAF----------------------------------
PF04107         ----------------------------------------------------------------------