[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE38106.1


[Show Plain Result]

## Summary of Sequence Search
   1::494
 325::479  PF00990 0.0% 45.4545454545455  GGDEF domain 
   1::494


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRKEIGRRRRMSARLLIASSVITVLGFSAVCGSIMLDMRGNAQELARQTQENLASTISADINRNIEAYDL
PF00990         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SLRSVVSNLALPQLAHVDETLRRLILFDHASIARHFGSIQVFDAQGNLTIDSATLTPEKLNRGDEPFVSA
PF00990         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           HRDDPTVGLYISRPMQHRGTFAIVLSRRISGTDGRFLGVVAGSIRFSYFKQVFSRLRLEPDDTIGVVARD
PF00990         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GTLVMRTPFRPDVIGTNVMGAPGVRQVFSQRRGWYSGEGIIDQIPRMMVWADGTRPLVVIVGKSWSDVFR
PF00990         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           MWRHEAIRISLILLGLAIIVAGFTVFFIREIDRRAEAERRLEELATTDSLTGLINRRKFDTLIEREWRRA
PF00990         --------------------------------------------aahDplTgLpNRrlleeeleqelqra


                         -         -         -         -         *         -         -:420
query           LRMNTPIALLIIDADHFKAFNDGYGHQAGDQVLVGIALCIGDSVQRAGDCAARFGGEEFAVLLPGGSATA
PF00990         areqkslalllldldnFkeindtyGhaaGDevLqevaqrLssslrr.sdlvaRlggdeFiillpetssee


                         -         -         +         -         -         -         -:490
query           AQGVAETIRNKVAHWSVGQGDVTVSIGVASMTPAPGQHWPVLFEAADKALYAAKDLGRNCCVVAASRHDL
PF00990         aqelaerierllaelkepveasgeelyvtisiGiaavkpeegedleellkeADealyea-----------


                         *         -         -         -         -         +         -:560
query           TLAA------------------------------------------------------------------
PF00990         ----------------------------------------------------------------------