[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE38119.1


[Show Plain Result]

## Summary of Sequence Search
   1::496
 119::281  PF05138 0.0% 25.7861635220126  Phenylacetic acid catabolic protein 
   1::496


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTANSTTRDPTGSHAMNIMNVDYSTKIPNNVDLASDRQVLKALEGWHPGYIDWWNDMGPEGFQQSLVYLR
PF05138         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TAYSVDPRGWAKFDYVKMPDYRWGVLLAPQEENRTIPFGEHYGEPAWQEVPGEYRAMLRRLIVIQGDTEP
PF05138         ------------------------------------------------wmpeeyrkaliryllqlAdsel


                         +         -         -         -         -         *         -:210
query           ASVEQQRHLGKTAPSLYDMRNLFQVNVEEGRHLWAMVYLLQKYFGRDGREEADDLLRRRSGDADSPRMLG
PF05138         ilaqrlsewigrAPsLeediallnivlDelGharllyslaeeleg.kg.rdeddlaflr..derefrnll


                         -         -         -         +         -         -         -:280
query           AFNEATPDWLSFFMFTYFTDRDGKMQLHSLAQSGFDPLSRTCRFMLTEEAHHMFVGETGISRIVQRTCEA
PF05138         lvelpngdwadtivrqflvdaaaillleaLkrssdgplaaiaakvlkEesyHlrhgaewvlrLgdGtees


                         -         *         -         -         -         -         +:350
query           MRDAGISDPTDIAKVRALGVIDLPTIQKKLNLHYTLSLDLFGSEVSTNAANAFNAGIKGRYHETQIDDDH
PF05138         k---------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RLANDTYPVLKFVNGEIKRVDEPALTALNMRLRDDYSQDCVKGLLRWNKVITTAGYDFQLALPHVAFHRA
PF05138         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           IGEFKGVHATPEGLLIDGATWARRKDDWLPSTDDGDFIASLMQPVSDPGAYAPWIAAPKVGIDNKPGDFE
PF05138         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           YVKIET----------------------------------------------------------------
PF05138         ----------------------------------------------------------------------