[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE38168.1


[Show Plain Result]

## Summary of Sequence Search
   1::249
  32::183  PF01012 0.0% 39.8648648648649  Electron transfer flavoprotein domain 
   1::249


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKVLVPVKRVVDYNVKIRVKSDGSGVELTNVKMSMNPFDEIAVEEALRLKEAGKATEVVVVSIGPAQASE
PF01012         -------------------------------egklnpvdlealeaArrlaekl.ggevtalvvGpveeaa


                         -         -         *         -         -         -         -:140
query           TLRTGLAMGADRGILVKAEGTVEPLAVAKILKAIADEEQPGLIILGKQAIDDDSNQTGQMLAALLGWAQA
PF01012         ealrealaamGadevllledpalagydpeatakalaalikkekpdlvllgatstgkd...laprlAalLg


                         +         -         -         -         -         *         -:210
query           TFASKLEVEGSDFTVSREVDGGSQTVKLKGPAIVTTDLRLNEPRYASLPNIMKAKKKPIAEKTADQYGVD
PF01012         tplitdvteleaeggkltvtRpieggnavvtvklpdrpavltv---------------------------


                         -         -         -         +         -         -         -:280
query           LAPRLEVLKTVEPSGRKAGVKVKDVAELVSKLKNEAGVI-------------------------------
PF01012         ----------------------------------------------------------------------