[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE38181.1


[Show Plain Result]

## Summary of Sequence Search
   1::219
  42::165  PF00005 0.0% 41.3793103448276  ABC transporter 
   1::219


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVRFENVGLRYGLGPEILRDLNFAIPAHSFQFLTGPSGAGKTSLLRLLFLSLRPTRGLVNLFGNDVSLLT
PF00005         -----------------------------------------STLlklltgelkptegeievd.ndrkdle


                         -         -         *         -         -         -         -:140
query           KDEVSALRQRIGIVLQDFRLLDHMTTYENVALPFRVSGRDESSYRKEVIDLLKWVGLGERMDALPPVLSG
PF00005         sdkleklr..igyipqdpllfpeltvrenldmakeekk.....tdkrieevlekvgldelldksrvstLS


                         +         -         -         -         -         *         -:210
query           GEKQRAAIARAVIGRPQLLLADEPTGNVDPTLGRRLLRLFVELNKSGTAVVIATHDINLMDQYEARRMVL
PF00005         gGqkqrvalArallkkpklllLDEP---------------------------------------------


                         -         -         -         +         -         -         -:280
query           HQGRLHIYE-------------------------------------------------------------
PF00005         ----------------------------------------------------------------------