[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE38253.1


[Show Plain Result]

## Summary of Sequence Search
   1::540
  28::364  PF01494 0.0% 27.5449101796407  FAD binding domain 
  29::64   PF01266 0.0% 51.4285714285714  FAD dependent oxidoreductase 
 144::211  PF01266 0.0% 29.2307692307692  FAD dependent oxidoreductase 
  29::200  PF07992 0.0% 26.890756302521  Pyridine nucleotide-disulphide oxidoreductase 
  29::62   PF00070 0.0% 47.0588235294118  Pyridine nucleotide-disulphide oxidoreductase 
 130::165  PF00070 0.0% 17.6470588235294  Pyridine nucleotide-disulphide oxidoreductase 
  29::63   PF03486 0.0% 48.5714285714286  HI0933-like protein 
 142::189  PF03486 0.0% 19.5652173913043  HI0933-like protein 
  29::63   PF00890 0.0% 34.2857142857143  FAD binding domain 
 133::186  PF00890 0.0% 20.7547169811321  FAD binding domain 
  29::77   PF05834 0.0% 34.6938775510204  Lycopene cyclase protein 
   1::540


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSLHQEHFHFGYRRHPDQDRDNDPARHPVVVVGAGPVGLSLAIDLAQRGENVVLLDDADRIGEGSRAICF
PF01494         ---------------------------dVlIVGaGpaGlmlallLseaGvrvvlvekhsttvvlprAdgl
PF01266         ----------------------------vviiGgGivGlstAyeLarrglkVtllekg.diasg------
PF01266         ----------------------------vviiGgGivGlstAyeLarrglkVtllekg.diasg------
PF07992         ----------------------------vviIGgGpaGlaaakrlarlglkvaliere.pggtclnrgci
PF00070         ----------------------------vvvvGgGyiGlElAaalaklgkkVtvierrdrll--------
PF00070         ----------------------------vvvvGgGyiGlElAaalaklgkkVtvierrdrll--------
PF03486         ----------------------------viviGgGaAGlmaAisaakrgakVllldkakklgr-------
PF03486         ----------------------------viviGgGaAGlmaAisaakrgakVllldkakklgr-------
PF00890         ----------------------------vvViGsGlAGlaAAleaaeaglkvavvekeqetgg-------
PF00890         ----------------------------vvViGsGlAGlaAAleaaeaglkvavvekeqetgg-------
PF05834         ----------------------------lvivGaGlAglllAlrlreakpglrvllidagpkllfgnnyt


                         -         -         *         -         -         -         -:140
query           SKRALEVWDRLGVGARMVEKGVVWQVGKIFRRDEMVYQFDLLPETGHKMPAFINLQQYYAEAYLVERVQQ
PF01494         nqrtmellrqlGledrilaegapnelmgealynelsdtrikverpkaradlelesspervtvypqteler
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF07992         pkkllleaaeee.................................eldlkeleerkdegievllntgvtd
PF00070         -----------------------------------------------------------iakilqkklek
PF00070         -----------------------------------------------------------iakilqkklek
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         --------------------------------------------------------------rllesare
PF00890         --------------------------------------------------------------rllesare
PF05834         Wsfeeed---------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LPQIDLRWRNKVTALAQHNDHAVLTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIA
PF01494         iLvehaeerg.lqvrfktevlsleqdeegvtavvrdketgeeetvrakYlvGaDGgrStvrktlgiefeg
PF01266         ---veiiegtkVtglereggr.vsgvrtedgs..iradkvvlAaGawsskllkllgldlpirpvrgqvlv
PF01266         ---veiiegtkVtglereggr.vsgvrtedgs..iradkvvlAaGawsskllkllgldlpirpvrgqvlv
PF07992         id....kakkkvel.adgka..............evkydklviAtGakprtlgipGvela----------
PF00070         n.gievllntkveeiegsadg.vev---------------------------------------------
PF00070         n.gievllntkveeiegsadg.vev---------------------------------------------
PF03486         -agvkirletevksvekee.dgafrvkt.kseeeleadklvlAtGGkSi---------------------
PF03486         -agvkirletevksvekee.dgafrvkt.kseeeleadklvlAtGGkSi---------------------
PF00890         agkvdfqerhradeLivedg.rvtGvvvenprsgrevrirakaavv------------------------
PF00890         agkvdfqerhradeLivedg.rvtGvvvenprsgrevrirakaavv------------------------
PF05834         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DVRMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAAVERLPENVRPRIERMLGNSDF
PF01494         eetvyeagvldvlfdadlsdivegvvlilsaesrgv.mviPlesanlerfyvqvearaekeer.sekfte
PF01266         t---------------------------------------------------------------------
PF01266         t---------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF05834         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           SFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAWKLAMVLRGDAPASLLDS
PF01494         eevkarlreavgektldveieevsawevaqrvaeryrkgrvflaGDAaHihpPtgGqGlNtaiqDaynLa
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF05834         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           YEIERSQAADDNIRHSTRSTDFIAPHSKQERRLRDVALALARDVEFAKRMVNAGRLSTPTAYDTPLSTPD
PF01494         wkLaavlkGeAkee--------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF05834         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           ADAWSAGPKPGAALLDAPLQAADGGPVFLTDAFKAAGCGFVLLEIANGAAAPAPQGVRSLRIGKDAPLRD
PF01494         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF05834         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           EEGLFTKRYDATPGAAYLLRPDGYVAARFRHPTQAALDAALARASGRAGR--------------------
PF01494         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF07992         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF05834         ----------------------------------------------------------------------