[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE38261.1


[Show Plain Result]

## Summary of Sequence Search
   1::781
 157::718  PF02738 0.0% 36.9888475836431  Molybdopterin-binding domain of aldehyde dehydrogen 
  20::140  PF01315 0.0% 49.5495495495495  Aldehyde oxidase and xanthine dehydrogenase, a/b ha 
   1::781


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGIEGIGASVVRKEDRRFITGKGRYVDDIKILGMTYAHFVRSPHAHAKIKNIDVEAAKAMPGVVDVLTGQ
PF02738         ----------------------------------------------------------------------
PF01315         -------------------tGeavYvdDiplpgalylafvrStkahAkiksidtsealalpGVvavitak


                         -         -         *         -         -         -         -:140
query           QIVDDKVGNLICGWAIHSKDGSAMKMGAWPAMAPETVRFVGQAVAVVIAESKNLARDAAEAVVVEYEELP
PF02738         ----------------------------------------------------------------------
PF01315         dvpeknkeig..asaeedee........dallakdkvrfvgqivalVvAedeeaArkAaelvkveYeelp


                         +         -         -         -         -         *         -:210
query           AVADIKAAIAPGAAQLHPEAPGNIVYDWEIGDQKAVDEAFGKAANVVSFELTNNRLVPNAMEPRAAIADY
PF02738         ----------------heslfekverektaekGd...veaafaeadvivegeytlgrqehfylEtqaala
PF01315         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           NSAEEHFTLYTTSQNPHVARLVLSAFYNIAPEHKLRVVAPDVGGGFGSKIFIYPEEMVALWASKKVGRAV
PF02738         vpd.eddeltiysstQvphvvrtvvakvlgi.pehkvrvikkrvGGGFGkkveslslavlaalaAlklgr
PF01315         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KWTGDRSEAFLTDAHGRDHVSKAELAFDADNRMLALRVKTHANFGAYMSLFSSSVPTYLYATLLSGQYNI
PF02738         PVklvldReedliatgkrhpfkikykvgakkdGkitaldvevladaGayadlsdavvlrallla..lglY
PF01315         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           PAIYAEVIGVYTNTTPVDAYRGAGRPEACYLVERLVETAARQLKVDPAELRRKNFITQFPHQTPVIMAYD
PF02738         kipnvriegtavkTNlppngafRGfGapqgsfalEalidelAeeLgidpleirrkNlv.kegdttplgqe
PF01315         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           IGDFGASLDAALKAADYSGFAARKAKAKAEGKLRGLGFSCYIEACGIAPSKAVGSLGAGVGLWESAEVRV
PF02738         lesgalee...lldecaksselrerk....kavekfnkenswrkrgvglvptkygsalgapdldqagarv
PF01315         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           NPVGTIEILTGSHSHGQGHETTFAQLVADRLGIPINQVSIVHGDTDKVQFGMGTYGSRSAAVGMSAIFKA
PF02738         rlesdGsvtvstggaeiGqGletkvaqiaaeeLgipledirvisgdtdkvpnssgtaaSrgtdvsgnAvr
PF01315         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           MEKVEAKAKKIAAHQLEASEGDIVIENGEFKVTGTDKSIALPMVALAAYTAHNLPDGMEPGLKESAFYDP
PF02738         kaaeklkerlkkiaakllesseedlewedg....vsaakadsvkesataayaee..etgfepgt...gsy
PF01315         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           TNFTFPAGAYICELEVDPGTGKTSFVNFVAVDDFGRLINPMIVEGQVHGGLVQGIGQALLENAIYDETGQ
PF02738         gksneyftyGaaavevevDtltGevkvlrvdavmDvGtslNPaivegQieGgfvqGiGlallEeivydee
PF01315         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           LVTASFMDYAMPRADDVPSFKVSHTETLCPGNPLGVKGCGEAGAIGASAAVINAITDAIGHNRLEMPATP
PF02738         GnlltrslldYkiPtiad----------------------------------------------------
PF01315         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           DRVWHAIHGNA-----------------------------------------------------------
PF02738         ----------------------------------------------------------------------
PF01315         ----------------------------------------------------------------------