[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE38351.1


[Show Plain Result]

## Summary of Sequence Search
   1::440
  44::380  PF00150 0.0% 29.1666666666667  Cellulase (glycosyl hydrolase family 5) 
   1::440


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDAAVPSHVADPPAIVRDAGDLRPAGRGGYLLPNGYLSTSGSQIVDASGRPVRIASIGWNGTEGPLGAAP
PF00150         -------------------------------------------sldasgkpvqlsgvntfwgnps.....


                         -         -         *         -         -         -         -:140
query           SGIWRVSYKTVLDSIVAAGFNAVRIPWTDIGLNAPLNGYSDRLGWINITLNPELLASSTPNSQGRYQYVT
PF00150         ...wydttkdlldeikdagfntvRipvswealysae.........pgykidee.................


                         +         -         -         -         -         *         -:210
query           TLVAFQRIVDYAQEIGLKVIFNHHTNQGTAGQQRNGLWFDLGPGTDNTDGIVPGRVTAETFKQNWLLVAR
PF00150         slerveevvdyakenGlyvildiHsesr.........wgdpnsltykde......eieekakkfwtqiae


                         -         -         -         +         -         -         -:280
query           TFANNPTVIGYDLHNEPNGDRGHITWGGGGPTDIKAMCEDVGSAIQDVSPGVLIICEGPETYKPPPASSG
PF00150         rfknddeilifelmNEPhgkg.....tsedannwkayaeeaidaIRavgpnaniivvgvpgwaqaekpdt


                         -         *         -         -         -         -         +:350
query           MDPRHAAPAGNLTAAGANPVKLKIANKLVYSIHEYPDEISDTKRWGLPEVGKGFIDRMNFTWGYLVRDNI
PF00150         lak............idnpiddkk..nliysvHfYgpsvfaqdtfed.....etnstdvvldniaeilve


                         -         -         -         -         *         -         -:420
query           APVWIGEMGASLRTPETREWARNLIDYMNGKYGQEGGPTFSGDQQPVSGSWWLIGPSNDPPFGLQTEWGV
PF00150         nglpviigEfGgsdasgggtdvkwaeayvd----------------------------------------


                         -         -         +         -         -         -         -:490
query           GNYRPDQIAITDEMLMRPRN--------------------------------------------------
PF00150         ----------------------------------------------------------------------