[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE38352.1


[Show Plain Result]

## Summary of Sequence Search
   1::306
  90::112  PF03808 0.0% 30.4347826086957  Glycosyl transferase WecB/TagA/CpsF family 
 116::288  PF03808 0.0% 40  Glycosyl transferase WecB/TagA/CpsF family 
   1::306


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPKAQDASRNPVSDPLNAERRAEERRVAPFHVSTDSSVSFEERRVTGERRRERFQQWQRNMIGGLPIVVA
PF03808         ----------------------------------------------------------------------
PF03808         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DRAETAKVMVDEALKRRGQWRYPAYMTSTNGEVTYRCAVDPSERAMFLEADAIHADGMPHVFVSRFKCQT
PF03808         -------------------kraPkwmrklgleWlyRllqePk---alnsadlvlpDGigvvlaarll.gr
PF03808         -------------------kraPkwmrklgleWlyRllqePk---alnsadlvlpDGigvvlaarll.gr


                         +         -         -         -         -         *         -:210
query           PLPERVATTDLFHDVAREASVRGATMFMLGADETSNRLATELVKRRYPKLKLVGRRNGFFADEAEEIAAC
PF03808         plkervagsdlipalleaaaekglrvfllGakeevlekaaerlkarypglkivgvrdgyfk.eeeeeaii
PF03808         plkervagsdlipalleaaaekglrvfllGakeevlekaaerlkarypglkivgvrdgyfk.eeeeeaii


                         -         -         -         +         -         -         -:280
query           RQIAELAPDILWISMGVPREQVFIRRHRHRLTTVGIIKTSGGLFDFLSGSKARAPQWMQRIGLEWLWRMA
PF03808         eeInaskadlvlvglGaPkQEkwiarnkerlkap.vvigvGgsfdflagkvkraPkwmrklgleWlyRll
PF03808         eeInaskadlvlvglGaPkQEkwiarnkerlkap.vvigvGgsfdflagkvkraPkwmrklgleWlyRll


                         -         *         -         -         -         -         +:350
query           LEPRRLGMRYLKTNPYAMYLLLTRTR--------------------------------------------
PF03808         qePkRlwr--------------------------------------------------------------
PF03808         qePkRlwr--------------------------------------------------------------