[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rpal2:ABE38359.1


[Show Plain Result]

## Summary of Sequence Search
   1::539
  72::193  PF00005 0.0% 31.6239316239316  ABC transporter 
 324::451  PF00005 0.0% 24.3243243243243  ABC transporter 
   1::539


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEERSAQLNYTSSSQDRPSDASAAAPPERPPLFQGLGLTKRYGDFTANSAIDIAIAPGQIHALLGENGAG
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KSTLVKTICGLIQPDDGAMRWRGAPFAPAGPADAQACGIGLVSQHFALFDNLTVAENVALGQRGGESLDI
PF00005         -STLlklltgelkptegeievdn.drkdlesdkleklrigyipqdpllfpeltvrenldmakeekk....
PF00005         -STLlklltgelkptegeievdn.drkdlesdkleklrigyipqdpllfpeltvrenldmakeekk....


                         +         -         -         -         -         *         -:210
query           LSRRLAQIAERYGLPLDPKREVWRLSVGERQRIEIVRALMQDPQFLILDEPTAVLTPAEADRLFDVLEQL
PF00005         tdkrieevlekvgldelldksrvstLSgGqkqrvalArallkkpklllLDEPt-----------------
PF00005         tdkrieevlekvgldelldksrvstLSgGqkqrvalArallkkpklllLDEPt-----------------


                         -         -         -         +         -         -         -:280
query           RADGRALLYISHKLEEVKRLCDTATILRAGRVVAACNPRAETAASLARMMVGVDVIPPKPQPGHSIGAPR
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LVVNGLSLAPDDPHGVTLKQIDLQLRGGEIVGIAGVAGNGQDELFAALSGEAPLDEARTILIDGQAAGDL
PF00005         -------------------------------------------Llklltgelk.ptegeievd.ndrkdl
PF00005         -------------------------------------------Llklltgelk.ptegeievd.ndrkdl


                         -         -         -         -         *         -         -:420
query           SITARRRFGAAFIPEQRLGHATVPTMRLSENALLTSHADPGVVRRGFVDRAALLGLVDRVTAAFGVRKAQ
PF00005         esdkleklrigyipqdpllf...peltvrenldmakeekk............tdkrieevlekvgldell
PF00005         esdkleklrigyipqdpllf...peltvrenldmakeekk............tdkrieevlekvgldell


                         -         -         +         -         -         -         -:490
query           RDPEAERLSGGNLQKFIVGREILRQPKLLVVNQPSWGLDAGAAAAIRQALIDLAAGGAAVLVISQDLDEL
PF00005         dksrvstLSgGqkqrvalArallkkpklllL---------------------------------------
PF00005         dksrvstLSgGqkqrvalArallkkpklllL---------------------------------------


                         *         -         -         -         -         +         -:560
query           LEIADSIAVMYHGRLSPPLAAAETGREQLGLLMGGSGWPQQSVHDAIPA---------------------
PF00005         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------